CAZyme Information: KLU82380.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU82380.1
• CAZy Family: AA7
• CAZyme Description: Glyco_hydro_cc domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0C4DNQ8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		37979.19	6.4921

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876966:4697827-4698885(+)

Full Sequence      

MKVIILATLPVLAVLAAPAPAANPLEITGPSGADMAVISSIEPDHVDKGGVTLGPVVPTE
QDIRTPPEGVIDDKEAELAFPINSTLDDAEGVLTRRTDAPYGIKKGLAYNNGGITNVLSK
AGSATWAYNWGAAMNAPKFQQIPMCWGVGSGCDAAGINKKIDKGDTPWVLGYNEPDETNA
NGGSNRTPRQAADNWGKDMFRFQTRGPKLVCPAISSWNTDKGHTGGPAGLQWLKQFVSAA
SKPSYYRCGAQALHWYGAQGESAARQAQLFIDYIAYAHVEVDKMYGTTMPIWVTEFSPLP
IGNVQMMADFLKIVIPWMNKQGWIHRYSPFMAEHLVTNGKLNNAGNVFVDTK

Enzyme Prediction     

No EC number prediction in KLU82380.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	120	342	1.2e-39	0.9464285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	1.18e-42	108	344	1	220	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS57615.1|GH128	8.54e-27	104	348	36	261
QSS67360.1|GH128	6.14e-26	104	348	36	261
CDR49642.1|GH128	5.19e-25	104	351	141	365
QGA17177.1|GH128	2.94e-24	104	348	34	257
QQK45735.1|GH128	4.42e-24	104	349	31	263

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UB0_A	9.53e-23	104	348	4	227	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -2 and -1 subsites [Blastomyces gilchristii SLH14081]
6UAY_A	1.77e-22	104	348	35	258	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]

Swiss-Prot Hits     

KLU82380.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000215	0.999766	CS pos: 21-22. Pr: 0.7964

TMHMM  Annotations     

There is no transmembrane helices in KLU82380.1.