CAZyme Information: KLU82307.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU82307.1
• CAZy Family: AA5
• CAZyme Description: dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435	GL876966|CGC1	48279.96	9.8702

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876966:4512373-4513861(+)

Full Sequence      

MAEATTSLPGRAVRFALDVANGRHLLSKLVGPALLALDVVLCALIILKVPYTEIDWEAYM
EQISQYVSGERDYTKIRGGTGPLVYPAGHVYIYTALYYLTNEGKNILLAQQLFAGLYLVT
LAVVMECYRNARAPPYILPLLVLSKRLHSVYVLRCFNDCFAVLFFWMAIYCFQRRAWTLG
ALVYSWGIGVKMTLLLSLPVVGLVLFLGRGFVGAIRVASMMGQVQVGIGLPFLSHNAWGY
LSRAFEFSRQFFFKWTVNWRFVGEEIFLSRAFSLTLLVLHASVLLAFVTARWLKPTGKSL
GQIAGTILSGRLPFNDHHELAVSGAVTPRYVLTSMLTATVAGLLFARSLHYQFYAYLAWS
TPYLLYRAGLHPVLQYGLWALQEWAWNVYPSTPASSAVVVGVMAVTVASVFIGATSEFKP
PPPPPRAAPKAVVPK

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	32	396	3.2e-150	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	32	396	1	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.
224202	NptA	0.005	179	364	94	270	Na+/phosphate symporter [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ56825.1|GT58	2.16e-221	1	420	1	420
EHA55153.1|GT58	7.18e-220	1	420	1	420
AGG35485.1|GT58|2.4.1.258	7.18e-220	1	420	1	420
AAK07848.1|GT58	7.35e-201	3	420	9	428
AEO60805.1|GT58	3.98e-199	1	420	15	434

PDB Hits     

KLU82307.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C1K8|ALG3_NEUCR	1.31e-201	3	420	9	428	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-3 PE=3 SV=1
sp|Q2U6A4|ALG3_ASPOR	1.43e-142	21	412	13	393	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	4.94e-137	21	420	75	463	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|Q4WVG2|ALG3_ASPFU	5.19e-134	21	400	21	389	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|A1DDZ3|ALG3_NEOFI	6.81e-130	21	400	13	381	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000012	0.000009

TMHMM  Annotations     

Start	End
25	47
82	99
106	125
150	172
193	215
266	288
394	416