CAZyme Information: KLU81914.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU81914.1
• CAZy Family: AA2
• CAZyme Description: mannan endo-1,6-alpha-mannosidase DCW1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331		36481.38	6.6344

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876966:3308878-3310021(-)

Full Sequence      

MVLLLKFIQVGLVAAALPKDLKVTDSASVQGVSKAIAADAMSYYKGTAAKYVDLTPPYWW
WQMGALSGAMLDYSHYTGDKSYDDVIATALLAQVGPEFNYMSPAHSGQLGNDDLGFWGFA
VMAAAERNFPQPPSKVPSWLKMGENIFNSLASRWDTTSCGGGLPWQIYKENPHGINYKNS
VSNAAFFQLAARLARATGNETYVEWANKVYDWSRTVGFVDANFHVIDGADRRENCQKLNM
VSFTYTSGVYLYGAAVMANYTDGNKTWTDRVMGFVESQKQYFGPADNATNVLYEPACELV
GTCNVDMKSHKGQLARFMWASTLMVPAIAKP

Enzyme Prediction     

No EC number prediction in KLU81914.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	26	327	1.9e-77	0.7821229050279329

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	3.96e-121	28	326	1	296	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	9.76e-09	160	261	133	225	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ57188.1|GH76	3.91e-177	1	328	1	328
AAX07733.1|GH76	7.00e-169	1	328	1	321
AEO60662.1|GH76	2.46e-148	13	328	17	331
AEO70787.1|GH76	5.12e-148	13	328	17	331
VBB73902.1|GH76	1.18e-137	12	328	16	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.23e-73	33	326	40	339	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74556|YCZ2_SCHPO	4.29e-82	14	329	17	326	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	1.10e-81	12	326	15	328	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q6FLP9|DCW1_CANGA	1.07e-80	20	326	20	323	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	1.26e-76	20	326	23	326	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q9P6I3|YHG7_SCHPO	1.58e-72	23	326	24	318	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.014282	0.985697	CS pos: 15-16. Pr: 0.9444

TMHMM  Annotations     

There is no transmembrane helices in KLU81914.1.