CAZyme Information: KLU81482.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU81482.1
• CAZy Family: AA11
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0C4DLC9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	GL876966|CGC6	42496.91	6.6374

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876966:1782224-1783491(-)

Full Sequence      

MAAFWGVFRASEAAPSRAWPQMRLAGVLALWLLLSPLARANCECGYAASVGNDTEQQVFT
DLLETDFTRVSDMSLNTDWARQAFNLTNERARGRHGEMFTVSNARSNPDRDRVGRSGIGL
NSEPAGLELVVGSNKMDGMVPVAEVDSARMDLLWGTFRVGMKLSGVPGTCAAFFWYHNDT
QEIDIEFLTREFNASNGTFPVNLVLQSRAAAEAGYNAQATGNFRKVNLSFDPTKDFHEYR
IDFLAGKVVFYADGKVLAEMGGAAVPTQGGHLILQHWSNGNPLWSGGPPPRDAVLTVSYV
RAYFNSSTAARQRDWASRCRDPGAPGAVCQIPSIPNVRNPPFFSAMSNMTNNQTVSSDPG
PGSKPAGESGSSTRLASGVSLVVVVAMAMVVLGL

Enzyme Prediction     

No EC number prediction in KLU81482.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	121	303	1.7e-87	0.9479166666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	2.98e-43	122	303	35	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	1.99e-09	155	294	69	201	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
395585	Glyco_hydro_16	2.70e-08	153	287	32	160	Glycosyl hydrolases family 16.
185693	GH16_laminarinase_like	9.80e-07	147	303	66	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185685	GH16_XET	1.61e-05	153	255	47	142	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ62950.1|GH16_23	7.61e-150	30	356	33	360
UQC77992.1|GH16_23	4.67e-140	34	370	15	343
AEO58087.1|GH16_23	2.80e-128	38	356	55	393
VBB86764.1|GH16_23	1.12e-126	24	355	28	367
CDP32289.1|GH16_23	1.59e-126	24	355	28	367

PDB Hits     

KLU81482.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53301|CRH1_YEAST	4.34e-07	152	297	104	247	Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRH1 PE=1 SV=1
sp|Q8LER3|XTH7_ARATH	7.72e-06	147	253	69	168	Probable xyloglucan endotransglucosylase/hydrolase protein 7 OS=Arabidopsis thaliana OX=3702 GN=XTH7 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004010	0.995961	CS pos: 40-41. Pr: 0.9314

TMHMM  Annotations     

There is no transmembrane helices in KLU81482.1.