CAZyme Information: KLU81213.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU81213.1
• CAZy Family: AA1
• CAZyme Description: GPI mannosyltransferase 4, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
521		59706.79	9.9738

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876966:956276-958295(-)

Full Sequence      

MWRRTYLLLVLVRLWFALSPSYLHPDENFQGPEVIAGQIFSYPVRHTWEFTSDRPIRSVF
PLWPIYGLPMLLLRWLWIGNGKDGEIPPIAVFWSLRVLMFVLGFVLEDWAIHELIESTRH
RRVAVLLVASSYVTWTYQTHTFSNSIETLVVAWSLVLMERIRDSQQRDSLMASTVLGMLV
VFGVFNRITFPAFLLIPGVRLIPYFWNRPLSLAVLLLSALLTTVVAIILDTAFYTKHQVS
WADIVFNPVITPLNNLLYNISPDNLAQHGLHPWYQHLLVNIPLLLGPGAVLLLVSAQRNS
PRLYSAMSGLFVLSIFQHQEARFLQPTVPLILSSVRLPRSRPLRRAWITAWVVFNAAMGV
LMGVYHQGGIVPTQVFMSKQPDATKAIWWKTYSPPIWLLNGKNEVLETRDVMSLGREDLF
AQLETVATCDTPADRRSLEYLREKNGTYLIAPLSATGLDPYLSNKGLDGLRFREVWRYQK
HFNFDDLDWGEDGVWKTLNRLIGRRGLAAWRVTKSCPGKKG

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	5	398	1.4e-81	0.9897172236503856

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	6.38e-50	5	397	2	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	1.56e-04	3	332	39	351	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO57845.1|GT22	1.99e-310	1	521	1	520
UNI14407.1|GT22	4.58e-303	1	516	1	515
ATY60246.1|GT22	4.36e-301	1	516	1	515
QLI65346.1|GT22	4.64e-300	1	516	1	515
UQC77828.1|GT22	5.02e-298	1	516	1	515

PDB Hits     

KLU81213.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I785|SMP3_GIBZE	2.65e-298	1	517	1	516	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q4WTT7|SMP3_ASPFU	1.39e-180	1	515	1	544	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	9.80e-180	1	515	1	540	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q5BAX7|SMP3_EMENI	6.96e-173	1	518	1	540	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	1.00e-100	10	488	13	495	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000413	0.999561	CS pos: 17-18. Pr: 0.9477

TMHMM  Annotations     

Start	End
59	78
89	111
123	142
177	199
212	234
273	295
347	369