CAZyme Information: KIX10598.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX10598.1
• CAZy Family: GT69
• CAZyme Description: Rhinocladiella mackenziei CBS 650.93 unplaced genomic scaffold supercont1.1, whole genome shotgun sequence [Source:UniProtKB/TrEMBL;Acc:A0A0D2HIW3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348	KN847475|CGC27	40104.54	9.7170

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847475:4751019-4752065(+)

Full Sequence      

MRRSLVIFLLITVIIVTLLLHSVSTLLSLLIEDASADAIHRSELPAPNSTLLETRPQLIP
KIIHQTYINESIPTQWVPAQKSCIDLHPDYEYILWTDQKSHDFIAQEYPWFLSTFVGYKH
NIQRADAIRYFVLSHYGGVYIDLDDGCKRRLDPLLSYTAFVRRTVPTGISNDVMGAIPQH
PFFQRVMESLQGANRSWILPYITIMASTGPLFLSVIWKKWMGEHAHLDRDTWIGRVRVLM
PDEYNKHAWSFFETYKGSSWHGKDARLIFWMGKNWMFLTALGFLLAGVVGLSIWWLYSHL
LIIGARRRTAGSPRIGAFRFGGSRVPLWRKWSGGIMKQSYELVGQHDA

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	79	156	1.2e-22	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.02e-72	57	290	80	310	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.22e-27	73	160	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA57874.1|GT32	2.35e-158	1	347	1	355
AAP47108.1|GT32	2.35e-158	1	347	1	355
QQK45416.1|GT32	6.31e-157	1	347	1	359
BCR89010.1|GT32	8.65e-157	1	326	1	310
CAK42232.1|GT32	1.27e-156	1	347	1	359

PDB Hits     

KIX10598.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	2.72e-100	1	268	1	267	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.10e-95	26	268	26	259	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.22e-85	48	313	46	309	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.26e-82	58	285	81	306	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	8.11e-55	59	311	64	306	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.373622	0.626350	CS pos: 26-27. Pr: 0.3119

TMHMM  Annotations     

Start	End
5	27
197	216
275	297