CAZyme Information: KIX10195.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX10195.1
• CAZy Family: GT59
• CAZyme Description: Rhinocladiella mackenziei CBS 650.93 unplaced genomic scaffold supercont1.1, whole genome shotgun sequence [Source:UniProtKB/TrEMBL;Acc:A0A0D2JL54]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	KN847475|CGC5	43037.06	7.1298

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847475:3597533-3598675(-)

Full Sequence      

MIVSTTSRRAVLVVVILLILFLLLRPSYPSSSDPFSVLPASEDIGQPSRSYPPPKPPKTS
QQDQQTMRDMASKPLRERLQYYFPYDVEAKFPAYVWQTWKSGPSSGKFEERLRPFEASWT
TLHPGFVHEVVTDNTAVHLISYLFASVPEVVEAYEAMPLPVVRADFFRYLILLARGGIYS
DIDTQALQSATDWLPQNLDKSTVGLVVGIEADPDRPDWNQWYARRIQFCQWTIQSKPGHP
VLRDIVATITADTLEMKKAGQLRKGKEPAKSIMEYTGPGVWTDAIFSYFNNKKYFDFSAR
QSNVTYSDFFGIKEHKKIGDVIVLPITSFSPGVGQMGAEGPEHPMAFVKHEFDGMYFSIR
TTDVQSLTKLQDPGSRRTSE

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	117	196	3.7e-20	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.46e-43	65	349	57	339	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.08e-18	118	197	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABA38731.1|GT32	5.88e-147	61	354	25	321
QVM11372.1|GT32	1.47e-146	61	356	54	352
QKX63547.1|GT32	6.13e-146	61	356	63	356
APA11100.1|GT32	6.87e-144	27	356	23	350
ATZ52760.1|GT32	7.85e-144	53	356	65	366

PDB Hits     

KIX10195.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	8.33e-91	75	356	83	375	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	9.27e-81	81	356	132	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	6.99e-74	75	350	114	381	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	3.95e-71	75	356	80	469	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.985865	0.014166

TMHMM  Annotations     

Start	End
12	29