CAZyme Information: KIX10101.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX10101.1
• CAZy Family: GT57|GT57
• CAZyme Description: Endo-1,4-beta-xylanase [Source:UniProtKB/TrEMBL;Acc:A0A0D2J362]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
225		24317.44	5.6618

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847475:3346385-3347136(-)

Full Sequence      

MVALSSVFLALTSALRAVSSPIDADFFNNTGNIDKRQSVSPGTGYNNGFFYSFWTDGGGS
VNYQNGPGGQYSVQWSNVGNFVAGKGWNPGSARIINYSGFFNPSGNGYLSVYGWTRDPLI
EYYVVESYGTYNPSSGATYQGSVTSDGGTYSIYTAQRVNAPSIDGTQTFTQYWSVRQSKR
VGGSVNLANHFNGWRNLGMNLGVHDYQIVATEGYESSGDSQITIS

Enzyme Prediction     

EC	3.2.1.8:61

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	47	223	1.2e-75	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	2.03e-106	47	218	1	172	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACJ26384.1|GH11	3.10e-107	1	224	1	231
BAB20794.1|GH11|3.2.1.8	3.10e-107	1	224	1	231
BAE62665.1|GH11|3.2.1.8	3.10e-107	1	224	1	231
QMW32914.1|GH11	3.10e-107	1	224	1	231
QMW44945.1|GH11	3.10e-107	1	224	1	231

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WP3_A	5.21e-94	30	225	11	207	Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) [Talaromyces funiculosus],3WP3_B Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) [Talaromyces funiculosus]
5K7P_A	2.39e-93	37	225	1	190	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei]
2JIC_A	1.38e-92	37	225	1	190	High resolution structure of xylanase-II from one micron beam experiment [Trichoderma longibrachiatum]
4XQD_A	1.89e-92	38	225	1	189	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQD_B Chain B, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],5ZF3_A Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],5ZH0_A Crystal Structures of Endo-beta-1,4-xylanase II [Trichoderma reesei RUT C-30],5ZO0_A Neutron structure of xylanase at pD5.4 [Trichoderma reesei RUT C-30]
1ENX_A	1.95e-92	38	225	2	190	Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1ENX_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1RED_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1RED_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1REE_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1REE_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1REF_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1REF_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1XYO_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1XYO_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1XYP_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1XYP_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],2DFB_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],2DFC_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],3AKP_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKP_B Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKQ_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKR_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKS_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKT_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKT_B Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3LGR_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4HKW_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4S2D_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4S2F_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4S2G_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4S2H_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],7MGU_A Chain A, Endo-1,4-beta-xylanase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HFA4|XYNA_ASPOR	5.50e-108	1	224	1	231	Endo-1,4-beta-xylanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xlnA PE=1 SV=1
sp|B8NKE9|XYNA_ASPFN	5.50e-108	1	224	1	231	Probable endo-1,4-beta-xylanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xlnA PE=3 SV=2
sp|A1DJ52|XYNA_NEOFI	9.66e-108	1	224	1	227	Probable endo-1,4-beta-xylanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xlnA PE=3 SV=1
sp|Q0CFS3|XYNA_ASPTN	1.52e-107	1	224	1	230	Probable endo-1,4-beta-xylanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=xlnA PE=3 SV=1
sp|Q4WG11|XYNA_ASPFU	1.59e-106	1	224	1	227	Endo-1,4-beta-xylanase xynf11a OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xlnA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000411	0.999581	CS pos: 19-20. Pr: 0.6968

TMHMM  Annotations     

There is no transmembrane helices in KIX10101.1.