CAZyme Information: KIX09243.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX09243.1
• CAZy Family: GT91
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0D2HEX5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515		59677.20	8.4140

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847475:903209-904829(-)

Full Sequence      

MDKGARVLTTRITDSEGDIFDHGTKRPSRLRQFGKGASSLGRDIKYWFDTATDAVQEWTP
FFLVLSYFIFSVCVYMVATPGVTKVFWFVYLMTNTYIASATVVEALMSIGPYHNAKKAVE
KMAKKNWTFPTPDDELLTLDICFVAYLPNEQDIILDRISYLLAKIVYPKEKLRIIMLYNT
PYPIEPLESQMHDLALKHSQLKVIKVPHSKSKADNLNYYCSLETFADVSAIFDCDHYPHP
YGPRWAIERFMADQNIETVQGRCVVFNSDENLMTAMISVEFDKIYAVSHPGRASMFDFGL
FCGSNGYWKTSLLRDLKMDGSMLTEDIDSALRAFGRGANVVHDLNVVSYELAPTAWPAFW
KQRLRWSQGWAQASYRHIHLVWSRSHPERKRTLIQRFGLLSLLYIRESSYYLITQYFCLV
VSLVITDFPQSGDDLLKLMFFQYPVAYWLFILSFICLLLTLYITFHTRSEFVRWWMIPVF
TVTYPVQLLLNAVMGLFGHARQVSKYVKWNPTPRA

Enzyme Prediction     

No EC number prediction in KIX09243.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133045	CESA_like	5.28e-29	145	326	5	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	7.34e-22	141	490	56	402	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133043	CESA_CelA_like	4.93e-19	138	372	2	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
133049	CESA_like_2	3.46e-18	162	372	23	232	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
133059	CESA_CaSu_A2	4.33e-16	230	369	92	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX64079.1|GT2	7.59e-249	1	514	1	524
QGA18997.1|GT2	9.36e-242	36	514	31	511
CAE7201725.1|GT2	1.89e-209	55	514	44	508
CBX90388.1|GT2	6.63e-209	49	514	34	504
ATZ50334.1|GT2	9.33e-199	51	514	20	483

PDB Hits     

KIX09243.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P96587|YDAM_BACSU	7.58e-14	149	369	58	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
sp|Q9SRT3|CSLC6_ARATH	4.32e-09	212	432	296	515	Probable xyloglucan glycosyltransferase 6 OS=Arabidopsis thaliana OX=3702 GN=CSLC6 PE=1 SV=1
sp|Q7PC70|CSLC2_ORYSI	7.63e-09	149	423	243	519	Probable xyloglucan glycosyltransferase 2 OS=Oryza sativa subsp. indica OX=39946 GN=CSLC2 PE=2 SV=1
sp|Q7PC69|CSLC3_ORYSJ	7.87e-09	212	423	336	547	Probable xyloglucan glycosyltransferase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC3 PE=2 SV=1
sp|Q9ZQB9|CSLCC_ARATH	1.01e-08	149	369	251	476	Probable xyloglucan glycosyltransferase 12 OS=Arabidopsis thaliana OX=3702 GN=CSLC12 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999753	0.000248

TMHMM  Annotations     

Start	End
61	83
87	109
403	425
440	462
475	497