CAZyme Information: KIX09099.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX09099.1
• CAZy Family: GT2|GT2
• CAZyme Description: Rhinocladiella mackenziei CBS 650.93 unplaced genomic scaffold supercont1.1, whole genome shotgun sequence [Source:UniProtKB/TrEMBL;Acc:A0A0D2ISX6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
796	KN847475|CGC24	89846.18	4.8985

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847475:498421-500811(+)

Full Sequence      

MSSRPRGLPLWGDLLISLFTLFSLYIASDASATASNDTLLWGPYRPNLYFGVRPRLSNSL
TTGLLWANSDSYSTTQRNFRHTCEQNEGMAGYGWEEYDVRNGGRQVIHDTENKIDLTIDF
VKVPGGQHGGSWAARIKGTPRADAPDTLVTTMIFYAGMEGLGELLSTASEPDPDGVVTLR
GQTNDLGEFDITFTESPENLLPYKTHPSWDAKPLDRPLMCSLQLPPEALWQAKNIAFASM
KQGIDALVKEYGQENMPPAWHAFTIQQDPGPGNFHMVQKVFVGPFEFDVLFNSATGPSVS
SESLAQAISTTSDSFKAKFKDVFKPLAPFTKPVYTAFSESLFSNLFGGIGYFYGDSLVDR
SYAPEYDEDNEGFWEEAAEARARAEIVRDPPVELFTSIPSRPFFPRGFLWDEGFHLVPIV
EWDLDVTIEIVKSWFNLMDADGWIAREQILGPEARSKVPPEFQVQYPHYANPPTLFLIID
ILMDKMSDGSSSARKARIESELRYLYPLLKRQYYWFRRTQFGDIKSYDREAFSTKEAYRW
RGRTPQHMLPSGLDDYPRPQPPHPGELHTDLISWVGMMSKTLSRLAAVLGENDDASEFTA
QSKAILRNIDDLHWSAEHKAYCDATIDDYEDSVHVCHKGYISLFPFMTGLLPASHPNLPH
VLSLISSESELWSPYGIRSLSKSDEFYGTDENYWRSPIWINMNYLILQNLLTVAQSANAP
AKVKTQAAKIYSELRVNLVNNVLAQWERTGFAWEQYNPETGAGQRTQHFTGWTSLVVVMM
RMPDLGAEAGIKHSEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	566	781	2.3e-31	0.43333333333333335

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	300	782	2	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	3.18e-114	39	258	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	2.63e-08	444	707	304	545	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
215307	PLN02567	5.10e-05	570	777	329	537	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM12625.1|GH63	0.0	28	787	37	808
QSS63216.1|GH63	0.0	34	796	40	818
BCS02288.1|GH63	0.0	24	796	29	822
BCS13967.1|GH63	0.0	24	796	29	822
QSS68976.1|GH63	0.0	18	796	9	818

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	6.57e-167	35	777	11	797	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	3.62e-139	29	780	27	775	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	5.68e-232	34	780	37	804	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	6.41e-166	35	777	41	827	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	1.63e-140	29	780	82	830	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	2.41e-135	29	780	82	830	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	4.89e-131	26	780	81	833	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.266534	0.733444	CS pos: 32-33. Pr: 0.5572

TMHMM  Annotations     

There is no transmembrane helices in KIX09099.1.