CAZyme Information: KIX08761.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX08761.1
• CAZy Family: GT20
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0D2IZB0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
692		80336.25	5.5150

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847476:4590562-4592640(-)

Full Sequence      

MGPIELNKRRIFFLVAGIVAFYIVFHVLSFSGDRFRDASAHIPIPGHLTPTGHKQPVPSD
PDDMWDLDPEPSPVVEPAADPTNPSSPPPSHAVEHFDLHPIARLMQEADDQWRVYETGIS
TTFRQTVEKYRSKYGRHPPPGFKEWYKFARKRNVFNVDDFEQIMDDLRPFWAVNASEIRI
RAAHMWENSDFGVAVIHIRNHKIVRVDNPSWRSETMEEIIGKFIQFLPDMDIPMNRLDQP
RVVVPWEDMQELLKKEYETRTMPPEVMDSFTQEPKDLLDMSIKDKEEDNSTRLDDEWFFA
PGQQYMKIAAKACPPDSPARTDITTKEADRLYKESTAGIVTNFNLSSDLCTVGPTIQDLH
GMLYSASSIIASHKLVPIFGECKVNVNNDILFPANMYYRHDERYDYNGEEDVDWRDKQDS
ILWRGVTSGGVQTEDNWPTMHRQRLVRLFNGTYTGQSGTEVKVLTEKREEPANANITYEL
YDRFQPSQFADRHSDVGFVESWGCVPNCSFYDTVFSWKPQVSLTSQFKSKYLIDVDGHSF
SGRWHAFLQSKSLGLKATIFREWHDSRLLAWRHFVPVDNRYDDIYALLTYFIGYGKPDME
HAMEGDDLNPRVYIAPHRKEAQKLARQGREWAHKVLRREDIEVYMFRLFLEYGRIIDDNR
NYIGYSGDGSELDKFDAGEENGSRWGFGGWKK

Enzyme Prediction     

No EC number prediction in KIX08761.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	371	656	3.7e-72	0.912

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	8.20e-18	368	654	23	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.74e-08	520	654	207	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA10807.1|GT90	4.38e-250	1	676	1	642
ATZ52302.1|GT90	3.43e-249	7	677	6	642
CCD43842.1|GT90	6.89e-249	4	677	3	642
VDB94907.1|GT90	2.48e-223	105	677	1	556
QSZ37292.1|GT90	2.43e-218	97	643	72	610

PDB Hits     

KIX08761.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.20e-47	99	661	152	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q6UW63|PLGT2_HUMAN	6.42e-07	371	655	246	466	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|Q9JHP7|PLGT2_MOUSE	1.95e-06	371	655	246	466	Protein O-glucosyltransferase 2 OS=Mus musculus OX=10090 GN=Poglut2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000000	0.000023

TMHMM  Annotations     

Start	End
12	30