CAZyme Information: KIX08148.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX08148.1
• CAZy Family: GT2
• CAZyme Description: Rhinocladiella mackenziei CBS 650.93 unplaced genomic scaffold supercont1.2, whole genome shotgun sequence [Source:UniProtKB/TrEMBL;Acc:A0A0D2HCH5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379		43492.39	6.5791

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847476:2834854-2836320(+)

Full Sequence      

MLLPKGGLTWKSAKARLPPWKAVLMFLTRTRFFYCFGPSKPPTQMTNNEMVAWNQHLQTP
VLFNHHEPYEVNASTIQRIDLNPIVSTSRAVSNQERVLILTPLRDAAPYLIKYFDLLSEL
TYPHELIDLAFLVGDSIDDTLAVLSSELNRIQQRTDKIPFHSVTIVEKDFGNSLNMDVES
RHGFAAQGPRRKAMGRARNYLLYAALKPEHSWVYWRDVDIVDSPKKIIEDFVAHDRDILV
PNIWFHRYENGRDIEGRFDYNSWIESDKGRRLAASLDKDVVLAEGYKEYDTGRTYLARMG
DWRNNKDEEIELDAIGGVNILVKADVHRSGINFPCYAFENQAETEGFAKMAKRAGYQVVG
LPNYVVWHIDTEEKPGNAA

Enzyme Prediction     

No EC number prediction in KIX08148.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	74	336	1.6e-108	0.9850746268656716

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	7.03e-159	75	337	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD70999.1|GT62	6.06e-230	1	378	1	404
UQC85603.1|GT62	7.06e-229	1	378	1	404
BCR85123.1|GT62	1.41e-226	1	377	1	404
QKX56390.1|GT62	2.04e-225	1	377	1	404
QBZ58943.1|GT62	4.52e-225	1	377	1	403

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	1.94e-65	76	372	6	303	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	7.34e-94	62	369	48	355	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	6.16e-93	74	369	75	372	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P23642|VAN1_YEAST	3.19e-77	74	369	170	512	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	3.04e-74	74	369	74	419	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	6.29e-67	76	368	73	365	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000004

TMHMM  Annotations     

There is no transmembrane helices in KIX08148.1.