CAZyme Information: KIX07916.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX07916.1
• CAZy Family: GT1
• CAZyme Description: Long-chain-alcohol oxidase [Source:UniProtKB/TrEMBL;Acc:A0A0D2IX31]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
763	KN847476|CGC10	82395.52	7.1968

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847476:2124968-2127259(-)

Full Sequence      

MSQTEVLSSLASLPSPLPPTPEVEVFTREQWDILFSIMGVFVPSISVSSDEKNSAISPAE
LDQAVSKLKQYLPEGSSEDVVKDYLAESIVPEPAFREHVARQFTLFIPPSGVKGLGFVLS
ALNTTVGSYLLTGYSSPIHTQDLLTRTSIVCNWAHSRLPPLRAVFRSVSGLARQSWIATS
LQIPRVIGFPPTPKHIERNPSYAFKFHDFTSPATPASLTTDVIIIGSGCGAGVTASHLSR
AGLKCLVLEKSYHFPSTHFPMSPNEGKEHLMENGGFVASDDGSIVVLAGSTFGGGGTVNW
SASLQPQYAVREEWAASGLPHFTGVEFQDCLDTVCERMGVAKATDLESLRKIEHNFTNSM
LLEGARRLGMNVEVVPQNTASKRHFCGYCTYGCASTTKQGPANCWLPDAAVHGTEFVEGA
FVEEIVFETIDGRKTAAGVKATWTSRDRQTTRSLAISAKRIIVAAGALNSPLVLLRSGLI
NPHIGANLHLHPTSTIWSVWPQRTNPWEGSILTVAVTSLEDQDGAHHGPKIEAICSTPAF
GIANLPFRVPATRTQKPILSSALDLRLNAAKHGHGAGFISITRDADSGRVYFDPSDPTRR
RVRIAYTPSSRDLRHLLAGQLAAARIQFVMGASEIDTCHPGGERWVRPSSVSVAVNTSTD
VDVDEESFCRWLASIRARGLTSPDPCMVGSAHQMGTCRMSSSSKNGVVDKHGKVWDIDGL
YVADASVCPSATGVNPMITTMGIAEWISRGIVKEIKRDKNQGD

Enzyme Prediction     

No EC number prediction in KIX07916.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	214	752	3.2e-55	0.9744525547445255

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	1.73e-59	268	493	2	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	3.84e-42	213	757	1	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	8.96e-31	588	745	5	141	GMC oxidoreductase. This domain found associated with pfam00732.
235000	PRK02106	3.15e-07	417	748	219	528	choline dehydrogenase; Validated
274143	pyranose_ox	4.57e-06	692	756	483	547	pyranose oxidase. Pyranose oxidase (also called glucose 2-oxidase) converts D-glucose and molecular oxygen to 2-dehydro-D-glucose and hydrogen peroxide. Peroxide production is believed to be important to the wood rot fungi in which this enzyme is found for lignin degradation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	1.35e-175	17	761	16	740
ATY58902.1|AA3_3	1.00e-10	221	755	11	606
AGE97206.1|AA3_1|AA8	1.07e-09	210	745	225	759
AGE45679.1|AA3_1|AA8	1.07e-09	210	745	225	759
UJO12159.1|AA3_3	1.56e-09	215	755	8	589

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F97_A	1.35e-09	446	754	250	530	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
4UDP_A	3.11e-09	446	754	250	530	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]
4UDR_A	4.94e-08	446	754	250	530	Crystal structure of the H467A mutant of 5-hydroxymethylfurfural oxidase (HMFO) [Methylovorus sp. MP688],4UDR_B Crystal structure of the H467A mutant of 5-hydroxymethylfurfural oxidase (HMFO) [Methylovorus sp. MP688]
6ZE2_A	4.83e-07	434	754	240	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3LJP_A	7.22e-06	461	745	265	520	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9LW56|FAO3_ARATH	2.41e-90	221	755	234	740	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|B5WWZ9|FAO2_LOTJA	3.85e-86	221	757	240	748	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|B5WWZ8|FAO1_LOTJA	1.42e-84	221	759	238	748	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|Q94BP3|FAO4B_ARATH	1.85e-78	221	756	239	743	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|Q9ZWB9|FAO1_ARATH	9.85e-73	221	759	247	756	Long-chain-alcohol oxidase FAO1 OS=Arabidopsis thaliana OX=3702 GN=FAO1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KIX07916.1.