CAZyme Information: KIX07109.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX07109.1
• CAZy Family: GH76
• CAZyme Description: Rhinocladiella mackenziei CBS 650.93 unplaced genomic scaffold supercont1.3, whole genome shotgun sequence [Source:UniProtKB/TrEMBL;Acc:A0A0D2IMV0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		42741.39	8.6662

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847477:4340110-4341287(-)

Full Sequence      

MESNPSPRNNNPLQQFYGSRKSLRWVAFLVIAALATLYMTGQNYGPVTTSRKAKYLTPAE
LMKRPISKDLQTIPKLIHQSWSSTELPAKFERWSTTCRQQHPDWEWVLWTDEDNDLLVKT
HFPWLLKTYQSLPSVIYRVDLVRNLYLYMFGGVYADLDVECLRPSDEMFTKFNVSTISHA
KPRHQSQPHMQKSGRKAFFGRMGVDTGSSNSIPNAWMASTPGHPFFLVVLESVMRSLADG
SAEGQSPESVTGPGRLYDMIKIYQEPESRYEGEKIDKHVAKNPTAKQFTPRKGLGHSIEV
LHFSYIYPYSWERDGEIVRDICWAAKKSFDADRCKQLLATDRWPSYAITYWSHTWTGDGH
DEGNVRNLDDR

Enzyme Prediction     

No EC number prediction in KIX07109.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	93	168	4.6e-19	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.82e-28	27	233	36	214	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.24e-16	91	167	2	85	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO66576.1|GT32	1.12e-100	52	365	77	407
QLI72987.1|GT32	3.64e-89	22	368	22	358
UKZ71055.1|GT32	1.29e-81	50	368	74	370
ANH56535.1|GT32	6.88e-80	48	371	79	379
BCS29894.1|GT32	4.18e-72	57	355	72	380

PDB Hits     

KIX07109.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	5.05e-24	35	235	18	190	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	7.27e-22	71	233	60	193	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	8.88e-22	69	235	60	201	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	1.88e-19	73	236	82	216	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	9.34e-19	71	233	53	186	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000005

TMHMM  Annotations     

Start	End
25	47