CAZyme Information: KIX05651.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX05651.1
• CAZy Family: GH36
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A0D2IR60]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
765		83101.02	4.8038

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847477:148402-150811(-)

Full Sequence      

MAGLFLSLFALGISTALSAVLSPRQGSSAWRDKSLPAAQRADDLLPQLSWEEKIGQMGGI
RQLLQPNATFNRTTWNTLYPLQHGILSYGSQLNQAQDVLPYANMVREEQLNSSKVPWISV
TDSVNSIYVPGGTIFPATLSLSTSWNLSMYEQVVAAIRDENMALGTHWVLSPELDIAKEP
RNGRVGEMYGEDVYLIGEFAAQYVRTMQGRDENGYIKVGTTIKHFLYGQGMGGVNTASMH
GGVNHLYNDLAIPYIRVLKENPTAVMISYSSIDRTPMSTNTALIQGMLRSEMGFRGLIMS
DAMGILHLYTESKVASSYKDAAVKALRAGLQLELAPGQPACFPFLVNSSNDQEIVNLVDE
AVRQHLVIKFETGMFDLPLPTPENLNRTLRAPQHLEINRQASRDAIVLLSNDGFLPQANL
TKIALIGPFGDILDPGSYAPSTAANPLHGQTLKDSLEVRFGSANIQYVKGVDIRSTSTND
TTGIEDAVAAAKNAGVAIVALGSLSVYFLDPITGQRTDGEFFSHASLGFPGSQQQLLDAV
LDTGVPTILVLNGGQAFVLNNSTMRANAILHQFLGGEFSADALVEIITGQVNPSGKLTIS
MPQAEGAFPIYYDYLPSDNVGGAGGFNGCAGDWSYPCLDRDGAPMAFGYGLSYTTFDISE
PQVLNSSGVSISCTVANTGDVVGKEVVQVYFRQQYSDIELPNKRLIRFEKIELQPGEARK
VEFTIDKNDLGYYNNAKYQVDSGNYTFWVGSSSRMADLKNVTISL

Enzyme Prediction     

No EC number prediction in KIX05651.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	112	334	2.1e-46	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.40e-105	6	754	4	755	beta-glucosidase BglX.
224389	BglX	4.67e-52	130	449	78	382	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	8.92e-52	4	726	8	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.07e-37	51	363	3	311	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	3.04e-36	406	653	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI87496.1|GH3	0.0	14	765	14	771
QGI70133.1|GH3	0.0	14	765	14	771
QGJ01022.1|GH3	0.0	14	765	14	771
CCT75117.1|GH3	0.0	14	765	14	771
QKD60600.1|GH3	0.0	10	765	10	771

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	2.04e-88	30	753	7	745	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.47e-87	30	753	7	745	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	7.48e-79	25	763	31	784	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5TF0_A	6.65e-74	133	765	97	750	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	5.42e-73	133	765	98	751	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KMH9|PLH34_FORAG	3.29e-83	27	765	26	754	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|T2KMH0|PLH24_FORAG	4.38e-78	128	765	83	722	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	7.08e-78	13	753	7	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	9.01e-75	13	753	7	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|A7LXU3|BGH3B_BACO1	4.74e-64	45	750	43	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.634912	0.365092

TMHMM  Annotations     

There is no transmembrane helices in KIX05651.1.