CAZyme Information: KIX04129.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX04129.1
• CAZy Family: GH16
• CAZyme Description: Rhinocladiella mackenziei CBS 650.93 unplaced genomic scaffold supercont1.5, whole genome shotgun sequence [Source:UniProtKB/TrEMBL;Acc:A0A0D2IE82]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
930	KN847479|CGC7	101877.99	7.4873

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847479:3284253-3287280(-)

Full Sequence      

MAANGDLLSRWDESRQLGQLFMMGFDGTSVTDQVKILIEKYHVGSILLKAQNLKSAEQAT
QLVLDLQTVAHQAGHPVPLLIAIDQENGGVNSLFDEVYIRQFPSAMALAATGSKKLAKDI
ARATAQELNSCGINWILGPVLDVLTNARNQPLGVRSVGDDPHEVSAYGVECIKGYQEGGV
ATCGKHFPSYGNLEFFGVPDDVPTITDSLENLSQNALVPFRTAIARGIDSMMVGGVAMAS
SQVNVMHACLSEQIVRDLLRHEMRFEGVVVSECLEMEALSRNIGISGGTVMAFKAGCDLI
LTCRTLSVQEDAINGLKAGLDNGMIERFRVQESVQRILNMKANYTSWEKAFSPAGIDNLA
RLQPLHTSLSTTAYNKSITVVRDQNHYLPISRVLKAEEELLLLTPLVKPLPASALFQQLQ
SEMTSSAPYARNSSLDANASIMSGEQVFREFGRSLARYRNGKISHTSYTANGVRPLHENL
LNRAQGVVVITADAGRNMYQNAFAKHISMLCKLAVGSDGRLKEKPCVVVAVSSPFDFAAD
SSIGTYVCTYDFTQTALQALVHVLYGELSPAGVLPGSFSQKPQTSQTRQQWLVEGFSEER
DSAALDVLLVQCQNEPSVLAGTLKNAVTGTFLLHDPEVEEAHFVVRNSSTKELFGFCTTY
YFKTSGVGHIGTIIVDPARRRLSIGHSLHDRAVRALLQKKGITKFQLGVRFPNVYLGIPK
LDPVEYKRLRQWFAKLGWNVSISTPVAKMMIRDLTTWSPPEGLGQALTNPEVKYDLVYGS
EYVDVTMEHLKRCARTDVQGIYQIALGNKEGCGIIRAKRASDQSILASILICRPGSKIAR
FIPSLYKQTGMACISSPVISTLFSDQVSLFQGLVLLGIRQFKKLGLQTVLLDYIREDVTI
NALKALGFAITHSFDEISSDPVHWTMMSAP

Enzyme Prediction     

No EC number prediction in KIX04129.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	74	301	3.7e-56	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.35e-73	16	391	6	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	3.38e-67	17	340	6	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	5.65e-35	22	329	5	306	beta-hexosaminidase; Provisional
185053	PRK15098	1.65e-11	101	392	119	409	beta-glucosidase BglX.
178629	PLN03080	4.04e-10	102	584	114	599	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS62698.1|GH3	0.0	15	929	7	923
BCS15461.1|GH3	0.0	1	928	1	929
QGA17051.1|GH3	0.0	4	927	5	949
BCS03847.1|GH3	0.0	17	928	1	911
QKX54839.1|GH3	0.0	4	929	5	924

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	3.60e-89	15	781	11	720	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	4.85e-64	15	575	15	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	7.53e-46	7	575	38	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	9.68e-46	7	575	12	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.47e-45	7	575	42	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	3.87e-45	7	575	38	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	1.73e-37	8	392	23	400	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	9.09e-33	28	383	49	419	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q0AF74|NAGZ_NITEC	1.03e-27	17	340	3	323	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
sp|Q82SJ8|NAGZ_NITEU	6.26e-27	17	370	3	347	Beta-hexosaminidase OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KIX04129.1.