CAZyme Information: KIX03927.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX03927.1
• CAZy Family: GH16
• CAZyme Description: Glyco_hydro_cc domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0D2FP76]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	KN847479|CGC7	38322.17	3.9534

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847479:2749981-2751051(+)

Full Sequence      

MGPYTIRGFLTLSVSHPLLTKTALLILVSLIVSPTTSSSSSSNDSSPDDNSSYSKRGLIY
ISPDSSDYDVLTDPASPLTWYYNYSPWPSSNLTSWTTNFAPMVHGTTSAATDVDTIKAVL
NGSAGVPLSNSPDQPGNSITHVLSFNEPDGDEDSGGSDSSPQHAAQVYIDTLLPLRSEPW
NLKLSLPATTGSPRGLEWLRDFNESCHDIQDSGCEFDFVATHWYGDFAGMASWLGQIHEL
YPQKDVWVTEFAIAGLDAYETEAFMNQSLPYLDGLDYVSRYAWFGTFRSDDANEWTGDGV
SMLDDDGALTALGAEYLGGKADGFEEGMGGGAAGVRHSFGLLVVSLMTALMTAFAS

Enzyme Prediction     

No EC number prediction in KIX03927.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	75	316	6.5e-57	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	1.47e-64	63	316	3	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT72013.1|GH128	1.26e-93	54	352	23	313
QGI84896.1|GH128	3.59e-93	54	352	23	313
QGI67667.1|GH128	3.59e-93	54	352	23	313
QGI98551.1|GH128	3.59e-93	54	352	23	313
QKD48718.1|GH128	3.40e-90	54	351	23	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UB7_A	1.87e-13	142	317	107	282	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]
6UAQ_A	1.10e-10	80	289	47	240	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	2.70e-10	80	289	47	240	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]
6UAS_A	6.60e-10	80	289	47	240	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei]
6UAT_A	6.60e-10	80	289	47	240	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei],6UAU_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose and laminaribiose [Amycolatopsis mediterranei]

Swiss-Prot Hits     

KIX03927.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.425115	0.574879	CS pos: 38-39. Pr: 0.5036

TMHMM  Annotations     

There is no transmembrane helices in KIX03927.1.