CAZyme Information: KIX03026.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX03026.1
• CAZy Family: GH125
• CAZyme Description: Beta-mannosidase A [Source:UniProtKB/TrEMBL;Acc:A0A0D2IID1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
891	KN847479|CGC11	101297.95	6.3930

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847479:264393-267292(+)

Full Sequence      

MAVITTQLSSGWKVKQTDDDSSNAWLPVSKVPTSIHQDLLDNGKIPDPFVDMNELSVRWI
AEKSWTYRTTFPSPTNVHSRARTDLVFKGLDTFATVTLNGKRILQTDNMFLEYRVDITGL
LNSTSNGSSNELKIVFDSALLRGRELVRQHEHEHRHIAHQTEQSRLPVRKAQYHWGWDWA
GILITTGPWRPVFLESYVGRVDDVWFQGQVSSDLKSVSGKLFARASLAGQKPRPGLRVKF
TLSLDGRVVYESQGDSDGDGVAMAAFRTEEPTLWYPHGYGKQTRYRLKAVLVGTDSESEM
SSKSKFVGFRRCELIQERDDFGKSFYFRINNVDVFAGGSCWIPADNFLSHIGPDRYRKWM
ELMIQGNQIMTRIWGGGIYEDDAFFDACDELGILVWQDFCFACGSYPTYPSFLHQIEQEA
RYNVRRLRSHPSLVIWAGNNEDYQIQEKYSLDYDYEGDKDPESWLRSSFPARYVYEYLLP
KVVEQEDPGSVYHPSSPWGDGKKTFDPTVGDIHQWNVWHGMMKRHQELPTMGGRFVSEFG
MEAYPHLSTISSAITDPAQQYPGSMVMDYHNRAIDHERRLITYVAENFQIKYDLPSFTHL
TQLTQSDAMGFAYRSWRRDWGTPGARKCGGVLVWQLNDCWPTMSWAVADYYLVKKPSFYA
IARALTPLAVGVARPFHDWTSGHADPTRATRDHTFDVWIASSRTETVQADVEVRFISIKT
GKDIAAAVEKNIDVQLNCTTDVLKQASADVSSSSSPHDPRQPFNTATHDPYVIHARLTVS
GTCISTDTAWPHPLKYLAFDDRGIKVQLSSAKDKLIVTANKPVHGFVFRENRDWVVFSDN
GFDVMPGEEVVVDIKCPEGFEMSELRWTYLGAESGLMGFAGEGEQKLAPKL

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	810	2.7e-88	0.7446808510638298

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	6.84e-66	8	670	15	634	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	6.27e-14	694	796	2	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
407625	Ig_mannosidase	8.88e-05	803	866	3	68	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
397119	Glyco_hydro_2_C	6.28e-04	384	443	64	137	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ88363.1|GH2	0.0	5	885	5	893
QLI66193.1|GH2	0.0	7	877	7	874
UQC76680.1|GH2	0.0	2	880	3	884
UKZ77816.1|GH2	0.0	5	881	5	887
UKZ51991.1|GH2	0.0	5	881	5	887

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	9.16e-135	7	672	28	660	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.41e-118	8	857	11	819	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.48e-118	8	857	13	821	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.52e-118	8	857	13	821	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	3.94e-118	8	857	11	819	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B7W2|MANBB_EMENI	2.46e-309	8	871	9	842	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
sp|A1CGA8|MANBB_ASPCL	9.86e-307	8	871	9	844	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|A1D911|MANBB_NEOFI	3.98e-306	8	871	9	844	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	1.13e-305	8	871	9	844	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|B0YBU9|MANBB_ASPFC	4.56e-305	8	871	9	844	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KIX03026.1.