CAZyme Information: KIX02988.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX02988.1
• CAZy Family: GH125
• CAZyme Description: Rhinocladiella mackenziei CBS 650.93 unplaced genomic scaffold supercont1.5, whole genome shotgun sequence [Source:UniProtKB/TrEMBL;Acc:A0A0D2GXU4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854		97063.70	5.5533

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847479:162919-165615(-)

Full Sequence      

MGDISGTAAQPAHMEVIDLSLGWSFKQTDDVGENSWCPVKKVPSTVHQDLIDNGKLENPF
IGFNEIKAEWVGLKSWTYRAKLARPSRAGPEARIVLAFDGLDTFAHVKLDGETILQSDNM
FLPHRVDVTEAIRSQDHHHLEIEFESAFLKAREIKDQHPDHKFICFNGDPARLAVRKAQY
HWGWDWGPLLMCAGIWKPVRLEIYSVRVADLRTDISVSDDHSLATIQASAEIEGLDRQHA
SVRARFFITQGETLICASDAIVMPDGNVSAPLQVANPELWMPNGYGKQSLYTVSVSIIGE
GIVLHTESRRVGLRQIQLVQEPDRHGKSFYFRVNDVDIFCGGSCWIPTDSFLTNVTPEKY
RAWIELMVPANQKMIRVWGGGIYENDAFYDACDELGILVWQDFMFGCGNYPCFPAILESI
EAEAVANVRRIRHHPCIAIFAGNNEDYQVQESAHLTYDYEDKNEKHWLASDFPARYIYES
LLPRVSAAEAPWIPYHPGSPWGDGKISSDPTVGDLHQWNVWHGTQEKYQVFDSLGGRFNS
EFGMEAFPHLATIKSFVEKEDDLYPQSHVLDFHNKADGHERRIATYLVENVRTATTLEAY
VHLTQLIQCEALMFGYRGWRKQWGDERHCGGALVWQLNDCWPVTSWSIVDYYRRRKPAYY
AMARVLAPVAVGIRRAHHDWSVTHAREPRTQEWELWVVSSRLSEITADVEVKFVSVRTGL
EIKEKMVKKGIKVQANGTTNVLTGYVDNVREEPHVLAARIWVDGELVARDTDWPQPLKYL
PFPDRNVRVEIVGDEMHVSAERPVKCLVFEEREGCHLSDSAIDVVPNDTQIIRVRGLEAG
EPALDWTFLGAGEQ

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	12	745	4.1e-96	0.6981382978723404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.52e-72	14	695	10	661	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	9.94e-16	691	779	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	3.14e-12	206	314	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236657	PRK10150	3.06e-08	93	332	83	295	beta-D-glucuronidase; Provisional
236673	ebgA	7.92e-08	93	399	127	394	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23201.1|GH2	0.0	19	850	9	842
UDD65874.1|GH2	0.0	19	850	9	843
BCS16892.1|GH2	0.0	19	850	10	843
BCS05337.1|GH2	0.0	19	850	10	843
QRD92384.1|GH2	0.0	19	850	9	843

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.66e-149	12	835	22	811	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	2.83e-126	15	841	7	825	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.97e-126	15	841	9	827	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	3.05e-126	15	841	9	827	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	7.97e-126	15	841	7	825	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXB7|MANBB_ASPOR	0.0	19	850	9	843	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
sp|B8NW36|MANBB_ASPFN	0.0	19	850	9	843	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
sp|Q0CCA0|MANBB_ASPTN	0.0	19	850	9	842	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|A1CGA8|MANBB_ASPCL	0.0	12	850	2	844	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	0.0	14	850	4	844	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KIX02988.1.