CAZyme Information: KIX02705.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX02705.1
• CAZy Family: GT8
• CAZyme Description: Rhinocladiella mackenziei CBS 650.93 unplaced genomic scaffold supercont1.6, whole genome shotgun sequence [Source:UniProtKB/TrEMBL;Acc:A0A0D2J1D3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460	KN847480|CGC9	52974.46	6.8882

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847480:2374470-2375913(+)

Full Sequence      

MLLRLFSQRSLLGIVLAIGILILLASFRFPEYLHTTNSPLPLVTLTPTPAPPAQLYPYCD
DTFSNFEDILVVVKTGANEIHDKLPTQLLTGLRCYQDILIFSDLEQRIGPFVVHDALKNV
SDTVKTQNPHFDYYRTLQDYKKNGQDITTLRQKSGKEAWDLDKYKFLHMLEDAWNMRPHR
KWYIFIEADTYLVRTNLLLWLQRQDPSQLLYLGSPTYVNGEGFAHGGSGVVLSGAALAKF
VNGDPGIAARYDQMLKSETFGDYVLMKALRDKGIVFSGRWPMLQAEKPSTIPFGPGPDNG
VRHWCQPIVTMHHITPEEACDLWEFEQQRKNPKEPLLLKELYQDMIKPKVHATREDWYNL
SDDLVYRPPDVIGDRQKSREDMSALEREAHLSFEHCGRACEEQPRCFQYMYSDRECRFSY
SYRLGRKHHPESGTTFMSGWNLAKIARDQAANQCSSPGWL

Enzyme Prediction     

No EC number prediction in KIX02705.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	0.002	180	239	85	158	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD58664.1|GT31	4.82e-157	69	460	62	453
QMW41467.1|GT31	6.54e-157	69	460	71	462
QMW29395.1|GT31	6.54e-157	69	460	71	462
QRD85744.1|GT31	6.54e-157	69	460	71	462
BAE59144.1|GT31	1.31e-156	69	460	71	462

PDB Hits     

KIX02705.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9JJ06|C1GLT_MOUSE	9.81e-06	142	242	124	225	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=C1galt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999978	0.000040

TMHMM  Annotations     

Start	End
5	27