CAZyme Information: KIX02398.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX02398.1
• CAZy Family: CE16
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A0D2GVW5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
829		90303.70	5.4136

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847480:1486230-1488846(+)

Full Sequence      

MGSMPLQTSFDVEDVLSKLDTAEKVALLSGIDFWHTAPVHRLGIPSIRLSDGPNGVRGTR
FFNGVPAACLPCGTGLAATWDTDLVKKGGALQGAEAIAKGASVILGPTTNMQRSPLGGRG
FESFSEDPYLAGAMSAATVNGIQSTGVAATIKHYVCNDQEDQRQAVDSILTERALREIYL
MPFMIAQRDSKPDCFMTAYNKVNGTHASENPRLIKDVLRGEWGFDGLVMSDWHSVKAGLD
LEMPGPTYIRGKLVNRALGCGKLGVPDVDDRVREVLKLIKKVEPLGIPENAPERTVDTPE
TSALLRSLASSGIVLMKNEKNILPFSKTKTTAIIGPNAAIAAYCGGGSASLLPYYAVSPL
DGLRSQVREAKYELGCPGWKSLPLMSRLTKTMEDKQGLTMKVYLDPPSVRDRRPIDEVYV
NKSDILLVDYKHPLIKSPLYWLELDGTFIPDETNEYEFSLCCAGTGKIFVNGECVVDNET
YQRPGNSFFGAGTAEEIGTLKLEKGLSYGIKVHFGTFPTMTFTNPGTTGFGAGGLRLGLE
RRAEIETEIERAVKLAKEVDQVVLCAGLNSDWESEGYDREHMDLPPGSDDLINAVFAANP
NTAVVIQSGTPVTMPWVKEVPALLQAWYGGNETGNAIADVVFGNTNPSGKLPLSFPLKNE
DNPAFLNYRSERNRAIYGEDVYIGYRFYEKTNKEVAFPFGHGLSYTSFEITNLAVSDNGV
DITVSASVTNTGMVDGAQVVQVYISQHEPSINRPKKELKGFSKVFLKAGSAGNVKIVISK
KYAASFWDEARDAWVMEKDVYDVLVGDSSASTPLKAQFKVHETSWWRGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	38	237	7.9e-65	0.8935185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.03e-83	41	812	101	757	beta-glucosidase BglX.
224389	BglX	8.82e-70	41	377	57	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	7.10e-56	313	705	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	6.62e-43	15	778	56	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.23e-41	41	278	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR64317.1|GH3	0.0	10	829	8	836
SMR61167.1|GH3	0.0	10	829	8	836
SMQ55981.1|GH3	0.0	10	829	8	836
SMY29662.1|GH3	0.0	10	829	8	836
UJO24157.1|GH3	0.0	10	829	6	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	7.40e-273	8	829	2	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.04e-267	8	829	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.79e-144	11	823	4	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	9.18e-117	16	809	9	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	6.25e-102	12	822	4	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CAF5|BGLI_ASPTN	0.0	8	829	2	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	0.0	11	829	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	0.0	11	829	5	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|B0Y3M6|BGLI_ASPFC	0.0	11	829	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	0.0	11	829	5	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999780	0.000265

TMHMM  Annotations     

There is no transmembrane helices in KIX02398.1.