CAZyme Information: KIX01979.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX01979.1
• CAZy Family: AA8
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0D2I805]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609	KN847480|CGC5	71125.42	6.2976

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847480:316499-318450(-)

Full Sequence      

MNLRTPNRSYVQGMIRSRKLLVLVCLLVTATFTTYLLRRPETLEESTSLLHGHHAHEENE
PLLPASSLLHPIHQLVAQAEGDFQTVLARQSRSLSDAVAEYRRRYKLPPPPHFDKWYNFA
KKRGVELIDEYDTIYHQLLPFWALEPAVIRERTREAIGFDNALIAVMIRDGKVTKIEGGG
DMYEWHREATPIMLKEFIMYLPDMDLAFNIHDEPRVVLQHDDLLHHVQVAKDENIPKAYA
NQGLSNGWSPRAEDLGEGIRIKEYKTTRFNRFAHQPTWSDSRLSCSPDSPARICLNDSCP
DNITAYTDLPLGFIRNTTAFSDICNSPSMEKSFGFFDRPNAFDVTHDLFPIFSQSKISSF
QDILYPSPWYYMGRVKYEKERDMPWEEKAPTMYWRGSTTGGFSRDGGWRRQHRQRFLAKI
QPLNTAKILELDNSTFTEDVWREKEISLQQMSHYFDVKFTYIGQCDPGDCDAQREYFGTV
EPVNMFDALASRYLLDIDGNAFSGRYYAWLLSNSLVYKLAVFREWHDEWLRPWVHYVPFG
LQGDEYVESVRYFDQEQSGKVEGKKIAGQGRQWAQKVLRNEDLEVWYFRLLLEYGRLIDD
NRYNIGFSL

Enzyme Prediction     

No EC number prediction in KIX01979.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	327	598	1.4e-79	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.13e-22	346	597	28	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	4.95e-14	350	597	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA13289.1|GT90	3.61e-261	16	607	2	588
UCK57446.1|GT90	3.65e-256	69	609	84	619
BAE54850.1|GT90	1.47e-255	69	609	74	609
BCR83603.1|GT90	1.45e-248	70	609	66	600
QKX56622.1|GT90	1.61e-245	16	609	299	888

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	4.19e-09	327	601	95	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	1.39e-06	350	598	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	3.63e-48	63	604	146	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	8.72e-10	327	598	138	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	8.06e-09	327	601	123	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8BYB9|PGLT1_MOUSE	1.42e-08	327	601	123	373	Protein O-glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Poglut1 PE=1 SV=2
sp|Q5E9Q1|PGLT1_BOVIN	2.50e-08	327	601	123	373	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000010	0.000005

TMHMM  Annotations     

Start	End
20	37