CAZyme Information: KIX01848.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX01848.1
• CAZy Family: AA7
• CAZyme Description: Rhinocladiella mackenziei CBS 650.93 unplaced genomic scaffold supercont1.7, whole genome shotgun sequence [Source:UniProtKB/TrEMBL;Acc:A0A0D2GU40]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471	KN847481|CGC8	53235.59	4.3024

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847481:2163407-2164863(-)

Full Sequence      

MRRRVIISVQFAALFAVFLFFGFYKYQSNPRDVTGYFSSEPVSDWPNSESGSSRMSFDQN
TAGGAAGDASNDANDDADYSEPNSPPNTGNATQPEVAQSYVDSILDDEDGSIDRLKCPVP
QWERYKYLRRDSAETTGTSHYRKYYFALDLYQCAPLLPRLMGSVVEAIRFLGPFDCAVSV
VEGRSDDGTWEILSLLRPQLEALGVAVYLTKNDVDPMGEGVYRIDALAELRNAALAPLQL
FRDQFSREETTVIFINDVAICTEDILELIRQRLYQNADMVCAMDWTYVGPEPTFYDVWIA
RGMTGDLFFNIPPDGSWDLAWDLFWNDPTSRAAQQSGRPFQVYSCWNGATAFTAKPIMDC
QIKFRVQFEDECPQGEPKSLCKDMWAKGYGKIAVIPSVNLEYSNEAGKRIKNSKGYVSRW
LQQGGSDDKIDWQISPPAEVKCMPTHENQFFEPWDAQLAENEHYPNCIILS

Enzyme Prediction     

No EC number prediction in KIX01848.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	143	385	3.2e-70	0.9916317991631799

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	5.43e-91	143	377	1	222	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC99639.1|GT69	2.42e-154	99	458	87	444
CAP61615.1|GT69	1.20e-148	105	456	1	350
CDP27968.1|GT69	1.20e-148	105	456	1	350
VBB79635.1|GT69	4.85e-148	105	456	1	350
CAE7199884.1|GT69	6.14e-148	90	458	74	441

PDB Hits     

KIX01848.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	5.13e-48	121	454	114	464	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.940899	0.059119

TMHMM  Annotations     

Start	End
5	24