CAZyme Information: KIX01397.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX01397.1
• CAZy Family: AA7
• CAZyme Description: Rhinocladiella mackenziei CBS 650.93 unplaced genomic scaffold supercont1.7, whole genome shotgun sequence [Source:UniProtKB/TrEMBL;Acc:A0A0D2FH96]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
680	KN847481|CGC1	77232.56	6.8503

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847481:829514-831664(-)

Full Sequence      

MSYPQETFFRTSLISGSLLARRREVVSSNTLLYQLDVLKKTGRYDAFKLQWHPSYSDPPD
VWPIPNHLFWDSDVAKWIEGACYFLREQPDPKIHVAVKELVQMIQSAQQPDGYINIHYTV
VEPGKRFTNLRDFHELYNAGHLIEAALAHNHLYHNDDLLGPMLKYVDLLCRIFGPGENQV
HGYPGHPEIELALLRLYHRTKDRKHLDLATYFITERGNPSGDHGKHYYVAEAERRNESPY
TRPRYWADSDALWYYQSQEPLVEQQTIQGHSVRAMYLLTAAADLVRSGKSPDARLKSGVS
RLWDNMVDCKMYLTGGIGAMKQWEGFGLDYFLPQGTDEGGCYAETCAAIGVMMLAERILQ
YDLDRRFSDVMELCLYNAVLTAMSHNGTKFTYVNQLASSDSDLSKREEWFTCACCPPNML
RLLGQVGGYICTQQKSGPEGPPSTQVNVHLYVSSRCEFETGHGQQVVLTQKTNWPWSGQV
EFNLCTKSDQVSLALRIPGWTTSWKMTPSPPTTTLRNGYLILPPTYLSSHPSFTLDIPIA
PRLVSPHPYTNQPILALSRGPIIYCVEDTDNTWVQDHFKSVQLDPHCQVVEKTVTDPKTG
DTYVSLTVINGGASVMKPQDVHASPSVEVTGLDEKLQRDVRTIEELNFVPYYFRANRGGS
GQMRVGLRRWNKASMGRIDR

Enzyme Prediction     

EC	3.2.1.185:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	15	565	2.3e-163	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226063	COG3533	1.60e-131	22	669	26	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].
400342	Glyco_hydro_127	1.31e-106	17	565	7	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT01986.1|GH127	2.68e-302	1	669	1	661
UJO16417.1|GH127	5.34e-295	1	669	1	680
ATZ54433.1|GH127	1.81e-291	1	669	1	661
QIW96336.1|GH127	3.71e-289	1	670	1	677
CCD50963.1|GH127	4.40e-288	1	664	1	656

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	5.25e-112	68	571	73	566	Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	5.48e-107	68	571	73	566	Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	4.53e-84	68	669	72	658	The crystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	5.80e-84	68	669	72	658	Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	1.57e-83	68	669	72	658	Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E8MGH8|HYBA1_BIFL2	2.33e-83	68	669	72	658	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KIX01397.1.