CAZyme Information: KIX01213.1

Basic Information

• Species: Rhinocladiella mackenziei
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Rhinocladiella; Rhinocladiella mackenziei
• CAZyme ID: KIX01213.1
• CAZy Family: AA4
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0D2GSA1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283		30990.17	4.1085

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RmackenzieiCBS650.93	11418	1442369	36	11382

• Gene Location: location=KN847481:215371-216222(-)

Full Sequence      

MAILAAVFLFLLGALAAPAHTTSESKYEPIKPRQTCGHVIDGVGTFMESAVYTFEGDTLP
AGLLASTDQLIPDEQWGAPFNHFFDSSNVAVQDGFAEVRVPGGQDPSSDPQRAIHSGEIF
TLESQILYASVRTAAILSTEPGTCQGLFFYKSENQETDIEYLSDINSLSNIGWEDGPPPL
HYTNQAVLEGGEKSWTRGPTPADVSSVHWYRIDWTPDYTAFFVDDVEQRRHTENVPSVPG
TWLWNNWSNGDPGWSVGPPLGDSALKIQTIEMYYNTSSSSTGC

Enzyme Prediction     

No EC number prediction in KIX01213.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	111	273	6.5e-33	0.8645833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	4.61e-28	81	273	24	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185693	GH16_laminarinase_like	3.44e-05	180	244	133	195	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185684	GH16_lichenase	2.52e-04	77	266	22	202	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
225182	BglS	0.004	199	281	186	266	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
395585	Glyco_hydro_16	0.005	208	234	105	131	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZS81947.1|GH16	3.93e-66	11	277	13	264
QPC59862.1|GH16	3.93e-66	11	277	13	264
CEF78656.1|GH16	3.93e-66	11	277	13	264
QPC71194.1|GH16	1.11e-65	11	277	13	264
UJO14875.1|GH16	1.56e-64	49	282	25	254

PDB Hits     

KIX01213.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q53317|XYND_RUMFL	2.93e-07	77	256	595	764	Xylanase/beta-glucanase OS=Ruminococcus flavefaciens OX=1265 GN=xynD PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000209	0.999795	CS pos: 21-22. Pr: 0.6235

TMHMM  Annotations     

There is no transmembrane helices in KIX01213.1.