CAZyme Information: KIW98535.1

Basic Information

• Species: Cladophialophora bantiana
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora bantiana
• CAZyme ID: KIW98535.1
• CAZy Family: GT58
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397		45224.08	7.5502

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CbantianaCBS173.52	12817	1442370	55	12762

• Gene Location: location=KN846980:551107-552353(-)

Full Sequence      

MDLGPSPRNGNPLQQLYGSRRSLRWIVFLVLAALAVIYMTGSSYQPYGAASSGDSSSGST
GHKSSTSGFKHPHKKQAKNLSPVDLMKRPISRDLQSMPKLMHQSWSSTELPAKFERWSSM
CKQQHPDWEWVLWTDEDNEELVRTHFPWLLKTYLGLPSVIYRADLVRNLYMYMFGGVYAD
LDIECLQPIDQLFAEYNVTTVSHGKPRPQSTQNMQKSGRKAFFGRMGTDTGSSNSIPNAW
MASTPGHPFFLIVLESVMKRMSEEGGDMENVEGITGPGKLYDMINEYTQPESKWAGEALD
KHVAKNPTAKQFNPRKGLKHSIEVLPFQYIYPYSWERDGEAFRDVCWATKETFNSERCKL
LLATDRWPSYTVTYWSHTWTSGGHDDGNVQKLEMSDQ

Enzyme Prediction     

No EC number prediction in KIW98535.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	119	193	4e-19	0.8777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.38e-25	78	288	64	244	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.28e-16	120	198	10	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO66576.1|GT32	2.65e-103	76	392	77	410
QLI72987.1|GT32	1.09e-86	77	392	50	358
UKZ71055.1|GT32	4.21e-84	73	394	73	372
ANH56535.1|GT32	5.05e-84	80	392	87	376
BCS29894.1|GT32	1.07e-73	72	379	63	380

PDB Hits     

KIW98535.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	9.10e-23	91	192	51	152	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	3.33e-21	82	287	64	243	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	1.29e-20	95	338	53	254	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	1.65e-20	95	298	60	230	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	9.80e-20	93	259	60	201	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000008	0.000006

TMHMM  Annotations     

Start	End
25	47