CAZyme Information: KIW96006.1

Basic Information

• Species: Cladophialophora bantiana
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora bantiana
• CAZyme ID: KIW96006.1
• CAZy Family: GH88
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552	KN846983|CGC7	60798.02	6.1959

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CbantianaCBS173.52	12817	1442370	55	12762

• Gene Location: location=KN846983:784038-786236(+)

Full Sequence      

MSNQFDFIVVGAGAAGCLLASRLSRTPPAPSVLLVEAGDSLDDPDLRDTARKFVNLADPS
LGWTRYSHVQKNVNGRRVAYPRGKGLGGSTMTNAMVYYVGPSDEYDFWADVTGSPKWRWP
ETKERFRRIERFHDDTPADFRKYAHTLPENHGSKGPLDVSLPSVWESGVWKVFEIAQAHG
YPINPDQNSGNPIGIGMSPSTVSHGLRATAASAFLENRPPNLMVWTNAFVTRILFAGRTA
VGVELADGRSARGTKATILCAGALDTPKLLLLSGVGPKADLVPLGIEVVHDLEGVGKNLQ
DHIQCLIETRLSKKLLDRDVVRHGEPDKAGPWSCLPFCFLKVDENLETEEFKLLDPSMQD
FLKGKTVPQLSLGMAAPLFSRGRVFPEDVCYYHVYVNCLMNPQSRGEVKLRSANPADPPH
FDFNALSHPYDLRTYINNTRKVMEFIEGDSNSEYFEGYINGPASKTDQDIETWLRAVSGP
QYHATGTAMMGKPETNKLACVGPDFQIFGVENLYVADLSVCPTTPCCMTQSTAYMVAETA
AETLIEKFGLKQ

Enzyme Prediction     

No EC number prediction in KIW96006.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	546	1.3e-136	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	6.61e-103	1	550	4	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.65e-95	1	541	2	528	choline dehydrogenase; Validated
366272	GMC_oxred_N	1.50e-34	72	302	13	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	1.32e-31	402	540	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.82e-22	3	536	54	568	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS73506.1|AA3_2	4.36e-133	1	549	1	564
QSS48722.1|AA3_2	4.37e-130	1	549	1	564
QSZ30159.1|AA3_2	3.58e-125	3	552	7	589
ATZ54666.1|AA3_2	8.68e-125	3	550	7	572
QDS74375.1|AA3_2	9.91e-121	3	550	9	568

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.04e-61	4	542	1	559	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.98e-61	4	542	2	560	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	1.22e-51	4	549	40	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6YS1_AAA	1.78e-47	3	547	6	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	2.45e-47	1	547	4	563	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9WWW2|ALKJ_PSEPU	3.70e-66	4	550	1	533	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q8NE62|CHDH_HUMAN	1.27e-64	3	542	39	569	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q988C9|4PADH_RHILO	1.21e-63	2	542	4	531	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q6UPE0|CHDH_RAT	3.86e-62	3	544	44	576	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q00593|ALKJ_PSEOL	1.24e-61	4	551	1	534	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999232	0.000797

TMHMM  Annotations     

There is no transmembrane helices in KIW96006.1.