CAZyme Information: KIW95003.1

Basic Information

• Species: Cladophialophora bantiana
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora bantiana
• CAZyme ID: KIW95003.1
• CAZy Family: GH64
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
826		90946.35	6.1268

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CbantianaCBS173.52	12817	1442370	55	12762

• Gene Location: location=KN846985:1865239-1868015(+)

Full Sequence      

MASGGELDVEWVLSQLGLEEKVGLLSGVGRCKTAGIERLNVPSINPRTCMLPCGTALGAT
FDSGLLRGVGELLGDEARGKNIQVVLGPVSCLQRSPLIGRGFEAFGEDPWLSGALAAAYI
DGVQSRKVAACLKHYAAHDQSWNSIEDNCVMTERTLREMHTLPFQIAVRQANPWSIMSSY
NKINGTHVSEHKHLLDEILRDDLKWDGIVISDWWGTYSTTGSIEAGMDLEMPGPSLWRGK
LLTWAVEAGKVPRATIDRRVRAVLNFIRKVQRPPPTDIKPYNDTPASRAFIRQVAAQSVV
LLKNNDNRLPLSKSAPRTYGLIGYHFQNPAVCGGGSSEVDAYYLNTPYDAFVEAVGENAV
EYQLGCYSHRFTPLIASGHTVPGSSEPGFLVQFYGENPHDKPDARCLYATVSLKSSMPFN
DSIPLFLPNVLFVSAKATYAPPNSGRFRFGLSISGKARLFVNGRESIDLWSEVPEKTAAT
PMLNSFTMEKCVDLDLNKGESIELEVLLTNEGIHSFVVGAAPAPGLRLGAYEVLDEDKTI
ANAVALARRVDVPVVLAGLSSDHEFENFDRRHLRLPGRQDELIKKVLDANPNTIVVTQSG
LPIGMPWLSKANSLLHAWFGGQETGHGITDVVFGDVNPSARLSVTFPKRVEDTPTYLMYG
KSDKNILYGEGVFIGHRYYEQVDREPLFYFGYGLSYSRFEYSNLQVPSEFEAREDHVMRL
SVRVSNVGTVDGSEIVQVYVGDADCTVLRPKKELKAFAKANIASGQSKEIKVELDKYAVS
YWSEVHGKWMAEAGVFTVIISRSADPLDHVLSADFTLPQTFLWAGQ

Enzyme Prediction     

No EC number prediction in KIW95003.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	51	232	1.5e-57	0.8611111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.63e-70	47	817	117	764	beta-glucosidase BglX.
224389	BglX	1.20e-62	50	362	82	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	4.85e-49	511	675	50	215	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	8.15e-40	12	775	56	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	5.08e-38	50	265	87	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62631.1|GH3	0.0	1	825	1	839
QGJ01758.1|GH3	6.13e-315	1	825	1	820
UPK95841.1|GH3	6.62e-314	1	825	1	838
CCT75598.1|GH3	2.87e-312	1	825	1	836
QGI70868.1|GH3	6.71e-309	8	825	294	1106

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.15e-176	6	825	3	844	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	4.37e-173	6	825	3	844	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	7.36e-131	7	804	3	657	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	7.16e-96	13	804	9	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	2.72e-89	9	794	70	807	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BA18|BGLK_EMENI	6.14e-202	4	825	8	837	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|A1DFA8|BGLI_NEOFI	1.22e-198	6	825	3	837	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	1.37e-197	6	825	3	837	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.37e-197	6	825	3	837	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	3.06e-196	6	825	3	837	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KIW95003.1.