CAZyme Information: KIW94622.1

Basic Information

• Species: Cladophialophora bantiana
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora bantiana
• CAZyme ID: KIW94622.1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
503	KN846985|CGC12	57340.76	5.1300

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CbantianaCBS173.52	12817	1442370	55	12762

• Gene Location: location=KN846985:767017-768706(-)

Full Sequence      

MAFPFRGINKTYLAILIVCIIFISCLGGPFTSYQPKVGTVEKLLYRATGNNNTNTNNNRT
VRSSDLEPGDVIEDNDTSPTHGLFNFYSGPWDPPGVSDLNEERMRIIEPYIKAITDPKDR
RFPRLRCPMPMRERYEIFRRRRSFGTRWDSPPRRWFFALNVHQCAPVLPRLLASVVETIR
FLRPEDCILSIVGRRSNDGTLEILEKIRDEMETLNVTYYFSTSDIDPFKEGSDYITEWAA
LRNLALDPLVRQPELYDPDTTVIFLNEAAFCTDDILELIYQRVYQKADMTCGMDWANHGE
TFNDVGASRGLTGDMFVKPPNTGDTNGTLFRNDPKTKTRFEAKLPFQVYSCWNGGAVFTA
KPLLRENITFRASRPGECQMGEPTLLCKDFWKYGYGRIAVVPSVNVGYNDDESRQTKKKY
GFATEIIQRVEADLDVGRHSKIRWQAAPPKTVKCESDMDHPSEDENEVEEAKKLAAEPFA
SSDNADKEPQKNIVYEDGGGPDL

Enzyme Prediction     

No EC number prediction in KIW94622.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	154	392	3.3e-65	0.99581589958159

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	1.85e-74	154	386	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC99639.1|GT69	3.96e-110	93	462	70	436
CAE7199884.1|GT69	1.43e-108	89	454	61	425
EAA28991.1|GT69	2.74e-103	110	460	93	444
UQC84687.1|GT69	2.12e-94	98	459	108	462
UPL03918.1|GT69	4.74e-94	107	454	132	473

PDB Hits     

KIW94622.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	3.01e-40	154	454	128	441	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.718734	0.281270

TMHMM  Annotations     

Start	End
12	34