CAZyme Information: KIW93786.1

Basic Information

• Species: Cladophialophora bantiana
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora bantiana
• CAZyme ID: KIW93786.1
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413		44329.77	4.2971

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CbantianaCBS173.52	12817	1442370	55	12762

• Gene Location: location=KN846986:249155-250675(-)

Full Sequence      

MSLARLASVVSVLAALGLASPAGPGWPLHGHYPPPPPPPAPVTATSSASPAPASSAPASC
SGYFEPHSPPFLNDLAQAAGKLWFGSATDQPGTGEDTNILYQEILNNTHIFGQITPANMM
KFELSEPEPGVFNFTGGDIDVAIARDHGKYLRCHNLVWVSQVSDWVLNGNWTADSLIAVM
QNHIQAMITHFGDACYSWDVVNEAIAANGSFSSSIWFDVIGPEYFFLAFQFAQEAVDSLP
AGTRKPKLYYNDFGIESGNKSVAVLGLIQELQSRNIRIDGVGLESHFVVGETPSLQDQIA
TKQAYIAAGVEVAITELDIRFPQASLTNATAFSLQAEEYYNSTASCIQVGGCVGITVWDF
DDQYSWIPSSFPGQGLADLYNADFRVSTHPSNPPVPSIGRICSTDVPLPVLFL

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	72	384	1e-74	0.9537953795379538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	1.38e-99	72	384	1	299	Glycosyl hydrolase family 10.
214750	Glyco_10	1.46e-81	120	386	1	256	Glycosyl hydrolase family 10.
226217	XynA	1.42e-63	109	375	56	317	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW72084.1|GH10|3.2.1.8	6.38e-136	72	385	31	344
QZB01317.1|GH10	2.46e-124	72	386	28	340
QBQ52894.1|GH10	9.80e-124	70	385	39	353
ACP27611.1|GH10|3.2.1.8	1.03e-123	72	381	29	336
ACS96449.1|GH10|3.2.1.8	1.33e-105	72	380	87	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F8X_A	1.52e-125	72	381	4	311	Penicillium canescens endo-1,4-beta-xylanase XylE [Penicillium canescens]
5XZO_A	2.63e-108	72	380	3	310	Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZO_B Chain B, Beta-xylanase [Bispora sp. MEY-1],5XZU_A Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZU_B Chain B, Beta-xylanase [Bispora sp. MEY-1]
6JDT_A	1.09e-89	72	375	3	295	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	7.77e-83	72	377	25	319	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3U7B_A	1.68e-69	72	385	5	312	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ZNB1|XYND_TALFU	8.45e-88	72	385	21	322	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|Q9HEZ1|XYNA_PHACH	4.23e-82	72	384	94	393	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|B7SIW2|XYNC_PHACH	9.16e-82	66	384	78	384	Endo-1,4-beta-xylanase C OS=Phanerodontia chrysosporium OX=2822231 GN=xynC PE=1 SV=1
sp|G4MLU0|XYN5_MAGO7	5.91e-78	72	385	38	341	Endo-1,4-beta-xylanase 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL5 PE=3 SV=1
sp|Q8J1Y4|XYN5_MAGGR	5.91e-78	72	385	38	341	Endo-1,4-beta-xylanase 5 OS=Magnaporthe grisea OX=148305 GN=XYL5 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999718	CS pos: 19-20. Pr: 0.9711

TMHMM  Annotations     

There is no transmembrane helices in KIW93786.1.