CAZyme Information: KIW93702.1

Basic Information

• Species: Cladophialophora bantiana
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora bantiana
• CAZyme ID: KIW93702.1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
822	KN846986|CGC4	90573.76	6.6198

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CbantianaCBS173.52	12817	1442370	55	12762

• Gene Location: location=KN846986:42154-45197(-)

Full Sequence      

MGDAGHRLESILHHLTLPETISLLSGKDTWHTVSIPHRGIPSIRVSDGPSGVRGRRTFQA
SPTTCFPCPIALASTWDVNLMKEIGTQMAGQAKAQGVHVIPTPTINIQRSPIGGRNFESF
SEDPVLCGLLASSLVCGIQHEGIATTVKHLVCNDQESQRKKIDVIVEERALREIYLKPFQ
MVVRNAQPWAIMAAYNRVNGLHVSENPHLLEKVLRSEWGWDGAIVSDWFATYSTCEALNT
GLDLEMPGKTEWRGKLVLRSLHAGKLEPPVLQQRARNVLNLVDKTRVSGVPEDAEEWENN
TPEVREANRKAATESVVLLKNAAKLLPIKTPGRVVIIGPNAKEELYCGGGSSTVFPYYYV
TAYDGIKRALELQSPSSELAFAQGCYKHALLPVLCTESADGQKGLDLQFFDRDFTQTSNA
QKVAETHSFTWRLVFLDSLPKAALPSVYGRLRGMYTGPSDGDFEFGVVTTGRAKLYIDGV
ALVDNWTKQERGNHFFGLGTKEVRGTINLTAGRQYEVVTEYSNISTLSDRTAADLAGGIL
RLGVCQVISPEALLNDALEAAALANTVICCVGTDQEHESEGWDRKNMKLPGSQDQLVQAV
LKANPGTASTVVQEWFMGSELGNALGDVLFGRVSPSGKLSVTFPRRLEQNLSYGNFPGEN
GRVRYAEGVMVGYRHYSTRHIPTLFPFGHGLSFTEFKYSELLFEGDNVLRPDGVVSVSLT
LTNIGDFTSHEIVQLYVSALTSSTFRPLLELQGFHKARDVQSGESRKMTFNIDKYAVSCY
DERQENWMAEAGKYRVSVGASVEDLRLATFIQVPATFHWSGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	35	247	1.2e-64	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.41e-67	64	810	118	762	beta-glucosidase BglX.
224389	BglX	3.27e-64	30	357	50	376	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	4.57e-38	39	281	65	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	2.57e-37	511	692	39	215	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	7.75e-31	7	773	52	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD55191.1|GH3	3.48e-232	3	822	17	851
UPK92097.1|GH3	6.08e-229	8	822	17	846
BCS12335.1|GH3	7.80e-227	4	822	18	846
BCS00565.1|GH3	7.80e-227	4	822	18	846
CCD50485.1|GH3	8.20e-226	8	822	7	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	9.17e-197	8	822	6	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.86e-192	8	822	6	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.05e-133	8	816	5	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.80e-117	12	813	9	663	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	9.62e-104	7	807	3	707	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CAF5|BGLI_ASPTN	3.54e-226	8	822	6	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	2.00e-225	8	822	6	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	2.26e-224	8	822	6	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|B0Y3M6|BGLI_ASPFC	4.95e-223	8	822	6	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.40e-222	8	822	6	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000005

TMHMM  Annotations     

There is no transmembrane helices in KIW93702.1.