CAZyme Information: KIW92435.1

Basic Information

• Species: Cladophialophora bantiana
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora bantiana
• CAZyme ID: KIW92435.1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
621	KN846989|CGC4	67874.66	6.0553

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CbantianaCBS173.52	12817	1442370	55	12762

• Gene Location: location=KN846989:1432274-1434139(+)

Full Sequence      

MSATIGDDANSSFNDAHAFMGNEYDFLIIGGGTAGLVLANRLSNEARFAIGVLEAGASHL
NDPLVDTPAMATAMTGDKDYDWHFITSPQGPQGLQCHLPRGRMLGGSSAINWMVYTRPSR
QDLDDWASLVGDPSWGAASMNKYLLRHQTLEPLDDALTERTGIAYVAEKHGLEGPIHTSF
NTLPVTPLEEAIYHAGIEASGLYAPLIDPWAGDHLGFYRSLGTIYRSGPNKGKRSYAARS
YLEPVLDRPNLHVLCNAHVTRIQLHGNRAVGVEIDHLGKHYLVKPRREVLLCAGALSSPH
ILQLSGIGDREVLEKAGIECKLESPYVGENLQDHPAMIVSYELKRGVISADAMKDEKVQR
AALDEYRKQGDGPLASINSIQGFVPILPLLNDKDLEEISRSVESQPGKSSFQKAQRQHIL
KQVKSAQSAYVHVSPTPVTVDCYAEGAVADQSKVFVKTLPEGAPHGFGFAVGMQYTFSQG
WVHATSSDPYAQPEINQNMLGHPADIVTASAALEFVQRLVDIPPLKDLIARRTYPGEEQY
DLHKQEDRREHAKGVWAAQYHLCGSCAMGEVVDTRLRFKGVEGLRVVDASVFPNHVSGNI
QSSVYMIAEKAADMILEDNLG

Enzyme Prediction     

No EC number prediction in KIW92435.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	23	618	2e-162	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.04e-111	20	616	2	532	choline dehydrogenase; Validated
225186	BetA	4.93e-101	17	619	1	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.87e-55	25	616	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	1.79e-36	98	336	21	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	1.48e-34	477	611	2	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR58876.1|AA3_2	4.11e-171	14	618	6	609
QQK46529.1|AA3_2	4.25e-171	19	618	12	608
SMQ54443.1|AA3_2	2.33e-170	14	618	6	609
SMY28092.1|AA3_2	3.30e-170	14	618	6	609
SMR62716.1|AA3_2	6.60e-170	14	618	6	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.35e-61	24	618	6	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.18e-60	23	618	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.19e-60	23	618	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	1.16e-57	21	615	38	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6ZE2_A	3.75e-51	22	619	4	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	8.26e-131	19	618	9	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	8.26e-131	19	618	9	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	1.60e-130	25	619	15	620	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	2.71e-79	21	616	44	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	2.71e-79	21	616	44	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999751	0.000275

TMHMM  Annotations     

There is no transmembrane helices in KIW92435.1.