CAZyme Information: KIW91811.1

Basic Information

• Species: Cladophialophora bantiana
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora bantiana
• CAZyme ID: KIW91811.1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
171	KN846990|CGC3	19042.43	9.3066

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CbantianaCBS173.52	12817	1442370	55	12762

• Gene Location: location=KN846990:966486-967152(+)

Full Sequence      

MGNTPSTPLFPPTRMSQKGIEFLKHQEGFKGEFSQDGKSAESGQSIGFGINCNANPKVCA
QIKEELQKTGKPLTKEQGEVYLRQILPQYEKAVRNLENSDKLSQNGFDALVSLAYHKGGK
GMSRTVKDRMKIQDMEGVYQAIKNDQTSSKAGETYSKRRLDEAELFKSSDN

Enzyme Prediction     

No EC number prediction in KIW91811.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	16	159	3.1e-18	0.9635036496350365

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381599	lyz_endolysin_autolysin	2.09e-13	19	166	1	135	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381620	lyz_P1	7.17e-05	68	125	39	96	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381621	pesticin_lyz	1.31e-04	20	165	4	177	lysozyme-like C-terminal domain of pesticin. Pesticin (Pst) is an anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. Pst contains an N-terminal translocation domain, an intermediate receptor binding domain, and a phage-lysozyme like C-terminal activity domain. Bacteriocins such as pesticin are produced by gram-negative bacteria to attack related bacterial stains. Pst is transported to the periplasm via FyuA, an outer-membrane receptor of Y. pestis and E. coli, where it hydrolyzes peptidoglycan via the cleavage of N-acetylmuramic acid and C4 of N-acetylglucosamine. Disruption of the peptidoglycan layer renders the bacteria vulnerable to lysis via osmotic pressure. The pesticin C-terminal domain resembles the lysozyme-like family, which includes soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides.
226295	RrrD	0.001	13	171	5	152	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
395766	Phage_lysozyme	0.003	69	161	15	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATA94635.1|GH24	1.10e-10	14	166	2	146
QHJ80311.1|GH24	4.08e-08	16	166	4	147
QGA25382.1|GH24	1.12e-07	14	166	2	147
QNS40176.1|GH24	1.14e-07	13	118	4	98
QQD12118.1|GH24	2.12e-07	14	166	2	147

PDB Hits     

KIW91811.1 has no PDB hit.

Swiss-Prot Hits     

KIW91811.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KIW91811.1.