CAZyme Information: KIW91689.1

Basic Information

• Species: Cladophialophora bantiana
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora bantiana
• CAZyme ID: KIW91689.1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458		52071.65	5.9962

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CbantianaCBS173.52	12817	1442370	55	12762

• Gene Location: location=KN846990:644167-645543(-)

Full Sequence      

MSDSFFSGGDLLSAVAQRKIARTARISSWDQSGLNEDAFVVLPGKTAVLADIEGPGKITH
LWFVQTCRRILGPGLIPYSKSGVAMMEIHNALGLNFEDSDPDYYRKVIIKMYWDDSETPN
VLAPIGDFFCLGHSMAANFQSLPFTVSVKPSEEKKFGGAAAFNCYLPMPFNKRAHIEIEN
QGEDAYFQYFYIDYELHPAPFDPKEILYFHAHWRRENPTNGWAPDNLQTNSLETQVPNLD
GKGNYTILETTGSGTYIGCNHSVLHFQGTWWGEGDDMIFIDDDEWPPSMHGTGGEDYFTQ
GWGMQKNAYPFCGTIIHEEDVPGYQVSYRWHLSDPVRFNSKIKVTLESGHANHLRDDWST
TAYWYQTLPGPKLEILPITQRLPNRPQVKAPEPAGPRSLPALTELQVEKIKQREERLKAF
VEDRNKWLERRSAASVERAAKNIEHAKDVKKRFLESLK

Enzyme Prediction     

No EC number prediction in KIW91689.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH172	104	366	3e-79	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402651	DUF2961	5.01e-112	105	366	1	234	Protein of unknown function (DUF2961). This family of proteins has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO68463.1|GH172	2.77e-292	9	457	11	456
QKD59092.1|GH172	4.04e-279	9	458	10	458
UPK94269.1|GH172	5.69e-276	1	458	1	457
CAK39208.1|GH172	9.53e-276	8	457	4	452
CAP93243.1|GH172	1.51e-275	8	457	4	452

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V1V_A	1.69e-154	19	406	15	399	Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_A Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1X_A Chain A, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_B Chain B, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_C Chain C, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_D Chain D, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_E Chain E, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_F Chain F, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium]
4KQ7_A	1.00e-49	22	384	20	345	Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492],4KQ7_B Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492]

Swiss-Prot Hits     

KIW91689.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000004

TMHMM  Annotations     

There is no transmembrane helices in KIW91689.1.