CAZyme Information: KIW91596.1

Basic Information

• Species: Cladophialophora bantiana
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora bantiana
• CAZyme ID: KIW91596.1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1322		144424.38	6.8939

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CbantianaCBS173.52	12817	1442370	55	12762

• Gene Location: location=KN846990:383210-388438(-)

Full Sequence      

MSPPQSWASLMASLLLLASLHQALAGPATYCKPVPSSINWPAQSAWQELNKTVSGKLFAD
VPPGSVCHPESALFNNATCAFVLSQWTDSNFHANNPISVDYNDDGCLPSPLAPCSAAAYP
SYVIHATNASDVQAAVKFASNTGVRLIVKGTGHDLLSRSSGGQSLSIWTHKIVGISVNTS
DTRALPYGGVGSVKIAAGSRMFEVYQAVAKHNLTVIAGGDMSVGIGGWVLGGGHSPISST
YGLGADQVLEIEVVTPDGKFLTVNEKSHPDLFWAMRGGGGSTFGVLISVTMKVYPTLPGS
LTIFWFNTTSNSDTFWSISTYFTSQVPKLSDKGANGYHYFIPYYASNPPNQAGMIFGGYF
FPNKTPAQATIIMDPVITKINTTNWGDEVFVSNYTIPISDFTKFWMTNQPEAVGPSERLG
SRLLTRGALTGNQTSLNNALRVASNGTWTLLNHLVAGQGVRNAKIPGGNNSVCPAWRNNT
YIHFVTYRNWTPLNQTQKTSVTNELRNSAIEALRVLDPYTGAYVNEADPTEPNWQTTFWG
SNYPRLLALKKQYDPKGIFWYDPNIHVTLRKELLAGGNSGSVGSGDTGLSFSEHPARRAN
QDDEDSLETILTATGRLCLDDGGRWRYHGHSSGPVFLQGLGERFVEQGVRNAEVGAVFTP
LQSVPWSPKSPSPPPGPGIALLLPPKGTAQKLVDCALGHGCAVLSFIHRPTFSQLFDWVY
ETEPENYGIQDARPRALVYSVLGLGCLFLRSKSVDLSSTIAIHEGTKYLAAARSLIDISD
CRELISLQALLCVTYILHCSGKMSVCHSYIAAAVAASLQIGLHRSLSSVLDPVEQETRKR
VFWAVRNMETYICAILGLPPAINEEDIDQEMPQEVDDMCIAPYGIMACQVQQLPAMTAVN
AHTRLVQIFAKILRYVYPVRHGSVGLANGANRPGEYRVSYRRVCEVEHELKLWWVNLPWE
LSNDNNRILKPLRIQRELLSIAYAHARLILYRPFLLNFSHHTMRNQSDVRAYTYAMACLY
ASHDVIIGMKNMKKVDMLNGPYWFTIYSTFFAVTSLISYAWERARDEGVSGVLRDAEIGR
DILSELGQRSIAAARCSKALEVLFEVLGKKLCENGEARGRMSEAAEPVTMCTGPEGVTEN
VVHDYHPRPELTGFTGMGQLNSVYYPGASRHEECSSSSNFYPHDAGATTPGSSFTPARDF
SFEAAQLHPPSYMDSPMPTAPRISFPHPSSANPQTPYSPQEQKQLFFSDSTAAFPVDESA
AAEEVDFTIGSGPSLNPATWPAFDLSRVENSGWGGGFLGQLSRAPLHRAVHGASWTKPND
AR

Enzyme Prediction     

EC	1.1.3.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	117	302	1.3e-49	0.38427947598253276

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
213391	fungal_TF_MHR	1.35e-60	684	1107	1	409	fungal transcription factor regulatory middle homology region. This domain is present in the large family of fungal zinc cluster transcription factors that contain an N-terminal GAL4-like C6 zinc binuclear cluster DNA-binding domain. Examples of members of this large fungal group are the following Saccharomyces cerevisiae transcription factors, GAL4, STB5, DAL81, CAT8, RDR1, HAL9, PUT3, PPR1, ASG1, RSF2, PIP2, as well as the C-terminal domain of the Cep3, a subunit of the yeast centromere-binding factor 3. It has been suggested that this region plays a regulatory role.
397964	Fungal_trans	7.39e-26	704	954	12	261	Fungal specific transcription factor domain.
214903	Fungal_trans	8.25e-20	784	877	2	93	Fungal specific transcription factor domain. This domain is found in a number of fungal transcription factors including transcriptional activator xlnR, yeast regulatory protein GAL4, and other transcription proteins regulating a variety of cellular and metabolic processes.
396238	FAD_binding_4	1.94e-16	120	264	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	1.60e-15	118	559	30	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	1.46e-58	23	560	492	1044
QKD57322.1|CBM91|GH43_11	1.46e-58	23	560	492	1044
QRW27390.1|AA7	1.14e-21	120	565	66	490
QRW06655.1|AA7	1.63e-19	120	565	68	495
QRV77710.1|AA7	1.63e-19	120	565	68	495

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	6.26e-67	31	560	28	553	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	1.72e-59	31	560	30	577	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6FYD_A	3.04e-21	120	298	45	213	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYB_A	7.22e-21	120	298	45	213	The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_B The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_C The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_D The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYC_A The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus],6FYC_B The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus]
4XLO_A	9.63e-21	120	298	45	213	Crystal Structure of EncM (crystallized with 4 mM NADPH) [Streptomyces maritimus],4XLO_B Crystal Structure of EncM (crystallized with 4 mM NADPH) [Streptomyces maritimus],4XLO_C Crystal Structure of EncM (crystallized with 4 mM NADPH) [Streptomyces maritimus],4XLO_D Crystal Structure of EncM (crystallized with 4 mM NADPH) [Streptomyces maritimus],6FOQ_A The crystal structure of EncM complexed with dioxygen under 15 bar of oxygen pressure. [Streptomyces maritimus],6FOQ_B The crystal structure of EncM complexed with dioxygen under 15 bar of oxygen pressure. [Streptomyces maritimus],6FOQ_C The crystal structure of EncM complexed with dioxygen under 15 bar of oxygen pressure. [Streptomyces maritimus],6FOQ_D The crystal structure of EncM complexed with dioxygen under 15 bar of oxygen pressure. [Streptomyces maritimus],6FOW_A The crystal structure of EncM complexed with dioxygen under 10 bar of oxygen pressure. [Streptomyces maritimus],6FOW_B The crystal structure of EncM complexed with dioxygen under 10 bar of oxygen pressure. [Streptomyces maritimus],6FOW_C The crystal structure of EncM complexed with dioxygen under 10 bar of oxygen pressure. [Streptomyces maritimus],6FOW_D The crystal structure of EncM complexed with dioxygen under 10 bar of oxygen pressure. [Streptomyces maritimus],6FP3_A The crystal structure of EncM complexed with dioxygen under 5 bar of oxygen pressure. [Streptomyces maritimus],6FP3_B The crystal structure of EncM complexed with dioxygen under 5 bar of oxygen pressure. [Streptomyces maritimus],6FP3_C The crystal structure of EncM complexed with dioxygen under 5 bar of oxygen pressure. [Streptomyces maritimus],6FP3_D The crystal structure of EncM complexed with dioxygen under 5 bar of oxygen pressure. [Streptomyces maritimus],6FY8_A The crystal structure of EncM bromide soak [Streptomyces maritimus],6FY9_A The crystal structure of EncM complex with xenon under 15 bars Xe pressure [Streptomyces maritimus],6FYA_A The crystal structure of EncM under anaerobic conditions [Streptomyces maritimus],6FYA_B The crystal structure of EncM under anaerobic conditions [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AS41|A7056_ARTBC	4.16e-89	5	560	2	570	Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07056 PE=1 SV=2
sp|A0A0E0RTV6|ZEB1_GIBZE	1.11e-79	15	560	11	542	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|A1CFM2|PATO_ASPCL	4.38e-74	9	560	4	547	FAD-linked oxidoreductase patO OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patO PE=1 SV=1
sp|G0R6T3|SORD_HYPJQ	4.62e-70	26	560	34	552	FAD-linked oxidoreductase sor8 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=sor8 PE=3 SV=1
sp|A0A1V6PBT1|CALF_PENDC	1.01e-68	6	560	2	554	Bifunctional decalin synthase calF OS=Penicillium decumbens OX=69771 GN=calF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000189	0.999819	CS pos: 25-26. Pr: 0.9789

TMHMM  Annotations     

There is no transmembrane helices in KIW91596.1.