CAZyme Information: KIW89256.1

Basic Information

• Species: Cladophialophora bantiana
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora bantiana
• CAZyme ID: KIW89256.1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
762	KN846996|CGC2	86098.58	5.2603

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CbantianaCBS173.52	12817	1442370	55	12762

• Gene Location: location=KN846996:416882-419225(-)

Full Sequence      

MTTRGLSIDGVRFRDAEGREVTFRGINVAGDCKLPRHPSQPSHELKDFFDAKNVSFVGRP
FTEEEAHIHFARIKRWGYNLIRYIFTWEALEHAGPGQYDEEFVEHTIKILRIAKSYGLYV
FMDPHQDVWSRFTGGSGAPLWTLHACGLDPETFVANQAAVVHNTWPNPAQFPKMLWPTNY
TRMATETTFTLFYAGRDFAPNAIIDGKNIQDYLTDHFISACAHLAQRIHDAGGLEDDCII
GWETMNEPHRGLIGWEDLDALPDELKMRKGTMPTPWQSILTGSGRATEVDVYEFSTFGSY
KSGRELVDPEGVSAWLSKDFDDTKYGWKRDPGWKLGECLWAQNGVWDPSQDQLLKPDYFA
TIPKSGEKLDYLKYTNIYYMQHFRKYRDAIRSIHKNCLILVQSAVLEIPPSIKGTVDDDK
RLVFSTHYYDGITLLQKHWNKYYNVDVFGILRHKYSNPVFAVRLGENAIRKCLRDQLRAI
REEGVNYLGEHPTLFTEIGIPFDMDDKYAYTTGDYSSQISALDANHFALEGSGSQGYTLW
TYNNHEWGDLWNGEDLSIVSVDDPLLPSVSTLSALPSANPSITSLGQQSTSHSSATLSDS
TTINPSNLKEALKTPQINQTLQPTLRTTEGTPGFRAAEAWVRPSPIATVGDVVSYGFDLK
TVTFTFSLTSDNPTNESVPTEIFLPEFHFPPGKTQVEVSGGRWRLDVLDVDGEGMQVMRW
WHGAGEQTMTVKGMKRKPGALNEEEDAEAGYLDTMRENCSVM

Enzyme Prediction     

EC	3.2.1.21:3	3.2.1.45:1	3.2.1.104:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	15	545	1.7e-219	0.9925788497217068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	5.80e-30	642	731	1	86	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.
395098	Cellulase	4.84e-05	58	127	20	88	Cellulase (glycosyl hydrolase family 5).
225344	BglC	2.36e-04	70	125	79	137	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	0.005	388	489	152	265	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA14319.1|GH5_12	0.0	1	762	1	764
QKX57385.1|GH5_12	0.0	1	753	1	745
ATZ47545.1|GH5_12	0.0	1	762	1	765
QGA22039.1|GH5_12	0.0	6	762	6	756
QSZ31155.1|GH5_12	0.0	1	752	1	769

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LPO_A	1.41e-204	11	752	26	782	Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99]
6JYZ_A	9.18e-10	6	252	25	227	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|H1AE13|EGCR1_ASPFM	0.0	6	762	6	759	Glucosylceramidase OS=Neosartorya fumigata OX=746128 GN=egc1 PE=1 SV=1
sp|P40566|EGH1_YEAST	7.65e-177	6	740	7	751	Ergosteryl-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGH1 PE=1 SV=1
sp|I1BTD7|EGCR1_RHIO9	3.13e-128	13	702	22	641	Glucosylceramidase OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=ERC1 PE=1 SV=1
sp|H1AE12|EGCR1_CRYNH	2.20e-89	6	732	16	678	Glucosylceramidase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=EGC1 PE=1 SV=1
sp|Q6L6S1|EGCSE_HYDVU	3.95e-06	15	251	34	234	Endoglycoceramidase OS=Hydra vulgaris OX=6087 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000077	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KIW89256.1.