CAZyme Information: KIW88395.1

Basic Information

• Species: Cladophialophora bantiana
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora bantiana
• CAZyme ID: KIW88395.1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
729	KN846999|CGC2	80665.87	4.8013

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CbantianaCBS173.52	12817	1442370	55	12762

• Gene Location: location=KN846999:393572-395809(+)

Full Sequence      

MLLLLSLACSLFGSALSDISVSVSGTTPFSLTVTSNQGVTVINKAILGGGTNNTASPVSA
SNDGVVSNSRGLIDWSLIQPNVVKIQYNSTFAFSGAQFVAEPNESFYGVWEYPWNDSLTN
NGVEFDLKGVGNSVGVNWDNARAPAFYSSAGYGVYADTLDMGSFQFSSGQTQFIFNTSSL
TYYIILATSPGDYKSIIETYTGLSARITMPPDSGYGPTFWSDNFEVDFHGSVSNAQENYY
DVVDHLYYNQIHATSMFADRPYGTGNYSWGDFDFDPTYYPTPKQFIANLSTWGFDFHVWA
ANRAFLDTELYNASVAGGWLFPDINPEYFLGPALNLSIPAAYEYFLKQMAYFPSVGVKGF
KIDRGEEGEMPVWEQNTQMRLFEQICETVMANKWGKSGFYNFARSVVDRSRSLTNVWNGD
SHANFTGLRYSIASGIRASLLGFSTWSSDTGGYIRSPNLVADQPTPELWARWMHFSSYSP
VYEIMVGTNHTPWYPPYPARLVSVLRATANEHHALVPYIKSFTYQATQTGIPVMRALFLE
APDDPTVYDTTDAYFFGDSFFVAPIVHEGGMRNVYFPKHTAGNRTARAYLEYYNKTSVCQ
GGSSAALNLEWEYSPVYVREGSIVVRGDINQGNNKWTQNWQPSLIIEAFPSYNYGTSSFP
YYNGMEVVNITLSSQPKLKTVLVRWDGSLGIPGQPQVVFYGKGGAQNATVKVFGAGGSAQ
VTGFQSIFS

Enzyme Prediction     

No EC number prediction in KIW88395.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	191	624	6.7e-67	0.9836065573770492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224418	YicI	1.76e-63	102	663	151	704	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	3.57e-56	183	624	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	1.42e-37	270	578	48	361	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
236731	PRK10658	5.31e-32	146	578	198	631	putative alpha-glucosidase; Provisional
236691	PRK10426	2.43e-28	98	578	76	587	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO21215.1|GH31	2.00e-259	40	696	52	703
AEY65035.1|GH31	2.33e-48	85	687	138	727
QEE26750.1|GH31	3.72e-45	144	626	151	640
ACL76784.1|GH31	5.96e-45	85	687	138	727
QPL05315.1|GH31	9.73e-45	97	649	152	691

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F2H_A	2.90e-30	104	631	160	676	Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1XSI_A	2.94e-30	104	631	160	676	Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
5F7C_A	1.10e-28	98	624	196	715	Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5F7U_A	2.23e-28	73	673	225	855	Cycloalternan-forming enzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]
5I0D_A	3.11e-25	73	673	225	855	Cycloalternan-forming enzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e],5I0D_B Cycloalternan-forming enzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AW25|AGDD_EMENI	7.18e-33	144	623	216	695	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
sp|P96793|XYLQ_LACPE	3.65e-31	72	628	126	678	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
sp|P31434|XYLS_ECOLI	1.49e-29	104	631	160	676	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
sp|Q9F234|AGL2_BACTQ	1.02e-22	148	631	196	681	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|B3PEE6|OL4AG_CELJU	2.75e-20	144	624	193	672	Oligosaccharide 4-alpha-D-glucosyltransferase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=agd31B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000422	0.999553	CS pos: 17-18. Pr: 0.9261

TMHMM  Annotations     

There is no transmembrane helices in KIW88395.1.