CAZyme Information: KIW87495.1

Basic Information

• Species: Cladophialophora bantiana
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora bantiana
• CAZyme ID: KIW87495.1
• CAZy Family: AA2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
633	KN847003|CGC1	70456.85	4.5047

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CbantianaCBS173.52	12817	1442370	55	12762

• Gene Location: location=KN847003:129257-131250(+)

Full Sequence      

MASWVALLLFVLGSATAQQIYIPAAGTSARPQCTDTPSYSQPTYSPYSTFTYSMTETVRT
ATSVQPGPTTTYAPPAASLTSLISSLSYTTWGKWDPNATVSATDTDNPYGNAAWTALWKS
ANPPNFTETSVFSTTVSPTPIPTSELVLPPPDYFGPTDCYYFPADFQFGVAGSAAQIEGA
TADEGKSPSLMDILIQDDRPKDYVTNENYYYYKQEIERLASMGVKYYSFSLAWSRILPFA
LPGTPVNQQGLNHYSDLIDFALEKGMIPVVTILHFDTPAQFFAANFSAAQAKPLIGYSNG
GYQNETFVEAYVNYAKIVMTHYADRVPIWFTFNEPFIYAFNGLSVDHVIKAHAQVYHFYK
ESINGTGKISLKFNDNFGVPRDPANPNDVYAADHFNSFQLGMFCNPIFLGQDYPESYKRT
VPDYVPLTAEDLAYINGTADFLGIDPYTATVVSPPVMNSTDSILECCSNTSSTYFPYCVN
QSTLTTTGWNIGYRSQSYVYITPRYLRLYLSYLYNTFHSPIVITEFGFPVFAEAEKTALS
DQLYDMPRSSYYLSYMAEVLKSIWEDGVPVVGAFAWSFADNWEFGDYGAHFGLQAVNRTT
QARSYKKAFFDLVDFVNTRTMPQAQGGPWGIGK

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	162	618	1.7e-101	0.9813519813519813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	1.84e-79	162	610	5	442	Glycosyl hydrolase family 1.
225343	BglB	9.07e-75	162	611	4	444	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	2.92e-38	162	603	28	465	beta-glucosidase
215539	PLN02998	6.43e-36	162	597	31	464	beta-glucosidase
184102	PRK13511	1.67e-33	162	607	5	454	6-phospho-beta-galactosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK97916.1|GH1	0.0	9	619	10	619
QLY89363.1|GH1	0.0	15	619	16	618
QKD48314.1|GH1	0.0	15	619	16	618
QGI75256.1|GH1	0.0	15	619	16	620
QGI58039.1|GH1	0.0	15	619	16	620

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7L74_A	2.81e-65	162	599	89	549	Chain A, Beta-hexosyltransferase [Hamamotoa singularis],7L74_B Chain B, Beta-hexosyltransferase [Hamamotoa singularis]
6M4E_A	2.81e-65	162	599	89	549	Crystal structure of a GH1 beta-glucosidase from Hamamotoa singularis [Hamamotoa singularis]
6M55_A	9.39e-65	162	599	57	517	Crystal structure of the E496A mutant of HsBglA in complex with 4-galactosyllactose [Hamamotoa singularis],6M55_D Crystal structure of the E496A mutant of HsBglA in complex with 4-galactosyllactose [Hamamotoa singularis]
6M4F_A	2.02e-64	162	599	89	549	Crystal structure of the E496A mutant of HsBglA [Hamamotoa singularis],6M4F_C Crystal structure of the E496A mutant of HsBglA [Hamamotoa singularis],6M4F_E Crystal structure of the E496A mutant of HsBglA [Hamamotoa singularis],6M4F_G Crystal structure of the E496A mutant of HsBglA [Hamamotoa singularis]
3AHZ_A	1.03e-57	160	623	10	475	Crystal structure of beta-glucosidase from termite Neotermes koshunensis in complex with Tris [Neotermes koshunensis],3VIF_A Crystal structure of beta-glucosidase from termite Neotermes koshunensis in complex with gluconolactone [Neotermes koshunensis],3VIG_A Crystal structure of beta-glucosidase from termite Neotermes koshunensis in complex with 1-deoxynojirimycin [Neotermes koshunensis],3VIH_A Crystal structure of beta-glucosidase from termite Neotermes koshunensis in complex with glycerol [Neotermes koshunensis],3VII_A Crystal structure of beta-glucosidase from termite Neotermes koshunensis in complex with Bis-Tris [Neotermes koshunensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	1.65e-57	163	603	12	458	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q5N863|BGL04_ORYSJ	4.79e-56	162	608	15	462	Beta-glucosidase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU4 PE=2 SV=1
sp|Q25BW5|BGL1A_PHACH	2.92e-54	163	608	7	448	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q9FIW4|BGL42_ARATH	7.43e-54	162	597	21	459	Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=2 SV=1
sp|Q5Z9Z0|BGL24_ORYSJ	1.33e-52	162	607	33	492	Beta-glucosidase 24 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU24 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000195	0.999761	CS pos: 17-18. Pr: 0.9803

TMHMM  Annotations     

There is no transmembrane helices in KIW87495.1.