CAZyme Information: KIW86924.1

Basic Information

• Species: Cladophialophora bantiana
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora bantiana
• CAZyme ID: KIW86924.1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1134		124982.27	6.2161

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CbantianaCBS173.52	12817	1442370	55	12762

• Gene Location: location=KN847009:242309-245713(-)

Full Sequence      

MRMICRHVTPPAVSLSTLLASVRLWQWLRGVCLVVLLARLDSIVTVHAQTPGQIKTLRKE
AEDLFYHGFENYMSYAFPEDELRPISCKPLTRDRDNPAHIEVNDPLGNYSLTLIDSLSTL
AILASNPSSSRHNKPLRLFQDSVRDLVEQYGDGSDGPSGQGLRARGFDLDSKVQVFETAI
RGLGGLLSAHLFAVGELPIRGYTPPQKQVAYAEIWQKDQFDGKKQGIFWPNAFEYDGQLL
RLAYDLGNRLIPAFWSATGIPYPRVNLRHGIPFYVNSPLNSAIGDGQCDARPGTPEITET
CSAGAGSLVLEFTVLSRLTGDPRFEELAKRAFWAIWQRRSVIDLIGGGIDAESGNWIGTW
TGIGAGIDSFFEYALKSHILLSRDAHPVYNSVDASQDPRILHESLSAEESTSGAFLNAWN
TAHAAIKRHLYRGSTYQHPHYIQADFSTGAARGFWIDALSAYYPGLLTLAGHVDEAVETH
LLQTALWTRFSALPERWNLVTGGIEGGLGWWIGRPEFIESTYYLYRATEDPWYFHVGEMV
LRDIKRRCWTRCGWASIQNVLTGEQTDRMESFFLGETAKYLFLLFDPTHPLNHLDEPFVF
TTEGHPLLIPRSVDNGSHRGPLWHPVHGEESFCPVKPSPLPLTISSIASRGDVYHAASLA
RLHLMPHRDNVESVLGEYAADHPSITLLDISSPSNHTYYPWTLPPELVPWNASSSLIPTR
PTLDISFPAVSPAGQPVPPLQRVKDGILINSIGGLRLGMIQDYPILFDDGFHDTFRIQTI
NNIPLGKDEKVYLARDTGKDVLSPADPNFTRIRDHVMLDLVIDLNRLIEDSDAGKPNEPA
ATAAGQESENGGEASFMIDLPKFEDGANDGAMRAAWNAIVSQISSLIRESRAPSPWPFST
ALSLTSTPATRRVSSSSTTSSSSPKVGAGNLLRYHLAAVTPTGPGAAPLPDWPEVSTLVS
PGASLPALSWTKIYVTDELCDHRLPVSVVKQHQILVVKRGKCDFSAKLENIPAYKPSAQA
LQLVIIVSFGQNEVVEHGGVGGEEDQPSARGVPNDDEGAHPDDAYDEANLIRPYLHQRQT
TPAGLPRRNPIPMVLVGGGRRVYDVFKNGAVAAGVKRRYHVETQGVRIANLDIV

Enzyme Prediction     

No EC number prediction in KIW86924.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	65	607	7.9e-137	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	8.16e-134	64	609	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	6.17e-56	58	610	73	519	glycoside hydrolase family 47 protein; Provisional
238300	PA	0.006	993	1048	48	98	PA: Protease-associated (PA) domain. The PA domain is an insert domain in a diverse fraction of proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following: i) various signal peptide peptidases including, hSPPL2a and 2b which catalyze the intramembrane proteolysis of tumor necrosis factor alpha, ii) various proteins containing a C3H2C3 RING finger including, Arabidopsis ReMembR-H2 protein and various E3 ubiquitin ligases such as human GRAIL (gene related to anergy in lymphocytes), iii) EDEM3 (ER-degradation-enhancing mannosidase-like 3 protein), iv) various plant vacuolar sorting receptors such as Pisum sativum BP-80, v) glutamate carboxypeptidase II (GCPII), vi) yeast aminopeptidase Y, vii) Vibrio metschnikovii VapT, a sodium dodecyl sulfate (SDS) resistant extracellular alkaline serine protease, viii) lactocepin (a cell envelope-associated protease from Lactobacillus paracasei subsp. paracasei NCDO 151), ix) various subtilisin-like proteases such as melon Cucumisin, and x) human TfR (transferrin receptor) 1 and 2.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS71303.1|GH47	0.0	48	1134	43	1125
QSS56460.1|GH47	0.0	48	1134	43	1125
BCR91747.1|GH47	0.0	52	1134	37	1111
QSS62002.1|GH47	0.0	64	1134	1	1067
BCS05200.1|GH47	0.0	53	1134	39	1096

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1FMI_A	2.36e-34	48	609	1	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	8.01e-34	49	609	2	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	1.32e-33	50	609	81	534	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KIJ_A	5.64e-33	58	609	6	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	2.61e-32	58	609	6	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94726|MNL1_SCHPO	2.15e-116	31	659	10	525	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q925U4|EDEM1_MOUSE	2.51e-105	51	613	118	585	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|Q92611|EDEM1_HUMAN	2.87e-105	51	605	123	582	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|P38888|MNL1_YEAST	1.71e-101	32	619	4	512	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL1 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	2.90e-87	55	612	35	481	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.099260	0.900742	CS pos: 48-49. Pr: 0.7870

TMHMM  Annotations     

There is no transmembrane helices in KIW86924.1.