CAZyme Information: KIW21035.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW21035.1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289	KN847492|CGC17	30979.08	3.9183

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847492:4407854-4408723(-)

Full Sequence      

MKSSHVLALSSALLSGVDAFYSGFNIGANLPSGACRSQSDWEFAFKKIASFPGNFKSARL
YASSDCNTLANAVPAAITTGTSLLVGIWTEDSNHFEAEKQALLEAIQQYGSDWILAVSVG
SEDLYRGDTDANTLASQINDVRGMLWGLGASSKSVGHVDTWTAWVDDANTAVIEAVDWLG
NDAYPYWQGVGIDNGAANDAYWAAVNQVRAVAQGKDVWTTETGQPISGDTVGNAVPSVES
LQTYWWQVSCASFSSLNYFFYDLDDFAASPSFAVVDSNYNPLIDMTCGS

Enzyme Prediction     

No EC number prediction in KIW21035.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	9.19e-43	22	274	46	294	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW94742.1|GH17	1.65e-110	11	286	10	286
APA06410.1|GH17	3.49e-104	1	287	1	295
UJO17243.1|GH17	2.67e-102	4	285	5	286
CCD34315.1|GH17	9.01e-102	1	287	1	294
ATZ46547.1|GH17	9.01e-102	1	287	1	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	5.90e-23	2	250	17	252	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	4.15e-22	2	250	17	252	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WG16|EGLC_ASPFU	2.88e-63	1	289	1	312	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	3.18e-63	1	289	1	312	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|Q2UUZ1|EGLC_ASPOR	1.31e-61	1	289	1	312	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	2.93e-60	1	289	1	312	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q0C7P6|EGLC_ASPTN	5.83e-57	1	287	1	311	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000349	0.999626	CS pos: 19-20. Pr: 0.9715

TMHMM  Annotations     

There is no transmembrane helices in KIW21035.1.