CAZyme Information: KIW20453.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW20453.1
• CAZy Family: GT34
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498	KN847492|CGC3	57112.54	9.5911

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847492:2730707-2732372(-)

Full Sequence      

MSSTRTPSPLRTGRWSAHGSADQASTLNGLGLGLDLSAQTNGYSGNDDQWAAAKAKSAQV
RGFPTIQTKNEGFFQRSRRKLTSTLPVFNSPYPPLSANWKDPEKLGRSRWSPGRESVFSM
VKTLLGNLLRKCKFLVIILALVTISTLIMSQTNLLSSIRSNAHLGGGSKFVIVLGANEGG
GVMSWKGPREWAIERDSVKNKKRYAERWGYQLEITDMSTKKRYAHEWRESWEKVDLLRNA
MARYPKAEWFWWLDLNTFIMEPSRSLQSHIFRNLQDNVYRDINVYNPLNITHPPVTKFLD
PISRSPTGDNLSSSIDIIIPQDCSGFNLGSFFIRRSPFTDRLLDMWWDPVLYEQKHMEWD
HKEQDALEHLYASQPYLRTHFAFIQQRKINSFPPGACAVETKEEPSDADKDKAQKSTTDP
RFHYSETERDFMVNMAGCEWGRDCWAEMYSYRELSNKLNRSAWEKFKDSASGIWTSVKGM
IGQKKVDQDNKGEDEKKS

Enzyme Prediction     

No EC number prediction in KIW20453.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	168	446	1.5e-82	0.9878048780487805

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	1.30e-75	168	444	3	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215616	PLN03181	0.009	231	254	183	206	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP69563.1|GT34	4.08e-180	1	480	1	457
CDP23580.1|GT34	4.08e-180	1	480	1	457
VBB72694.1|GT34	4.08e-180	1	480	1	457
AEO65857.1|GT34	4.11e-174	1	480	1	453
QDS68167.1|GT34	2.43e-173	1	472	1	444

PDB Hits     

KIW20453.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P50108|MNN10_YEAST	1.43e-96	169	466	121	390	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|P78817|YFE6_SCHPO	9.96e-77	168	465	73	342	Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.06 PE=2 SV=2
sp|O94622|YBKD_SCHPO	2.68e-27	168	463	102	358	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	1.29e-24	168	463	102	358	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q10359|GMH3_SCHPO	2.54e-19	198	403	112	304	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000002

TMHMM  Annotations     

There is no transmembrane helices in KIW20453.1.