CAZyme Information: KIW19298.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW19298.1
• CAZy Family: GT20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381	KN847493|CGC17	43064.15	6.2681

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847493:3550986-3552131(-)

Full Sequence      

MPSPLTVEGLQASDIHAKIESLMTNLVSIKDETGRFLQRLPDGRTIDTKGWNDWEWTHGI
GLYGLYQYHTLTSSATALDVITRWFSARLAEGTTKNINTMAVFLTLAHLYEKTGDQSHLA
WLDSWCEWAMHELPRTTFGAMQHITYVDENHNQLWADTLMMTVLPLAKVGVLLNRPDYVE
EAKRQVLLHVQYLFDPTTGLFFHGWQFHDEGDAAAGRGGHNFARARWARGNSWLTIAIPD
FIEILDLQPSDGLRMYLVSVLEAQCRALRALQTPDGMWRTLLDVAEDDGSYPEASATAGF
AYGLLKAVRKRYVPKEYRDVALRAVKAVLRRINDAGELGDVSFGTAMGHDLKHYVNIERT
SMPYGQAMAIMALVEFLRVFI

Enzyme Prediction     

No EC number prediction in KIW19298.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	48	378	1e-103	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	1.46e-107	25	380	7	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	6.40e-99	29	380	2	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS76750.1|GH105	6.29e-194	7	381	8	379
UJO23795.1|GH105	2.09e-192	5	380	6	378
SMR63772.1|GH105	9.85e-191	4	380	5	378
SMQ55448.1|GH105	1.14e-189	4	380	5	378
SMR60657.1|GH105	1.14e-189	4	380	5	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	3.54e-169	12	381	5	373	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3PMM_A	1.25e-147	13	378	25	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	3.97e-146	14	378	25	378	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	6.82e-38	54	378	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	6.30e-12	155	377	201	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	1.86e-10	170	329	10	163	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	1.86e-10	170	329	10	163	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KIW19298.1.