CAZyme Information: KIW18320.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW18320.1
• CAZy Family: GT1
• CAZyme Description: alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:A0A0D2BI71]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1100	KN847493|CGC18	121355.16	5.8802

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847493:891394-894696(-)

Full Sequence      

MHIGQHNVTPPAASLSSISGSWRLTKWLKFVSLVVLVISLTSIVRVEAQTPGQIKALKKE
VEDLFYHGYENYMAHAFPEDELRPISCKPLTRDRENPAHIEVNDPLGNYSLTLIDSLSTL
AILASSPSSPKYNKALHLFQDGVRSLVEQYGDGTDTEAGQGLRARGFDLDSKVQVFETAI
RGLGGLLSAHLFATGDLPIRGYSPVTKETVIAQKSPKSFTSNHTRVILWENGFKYDGQLL
RLAYDLGNRLIPAFWSSTGIPYPRVNLRTGIPFYTNSPLNVGTESEQSGPRQSAPEITET
CSAGAGSLVLEFTVLSRLTGDSRFEELAKRAFWAIWNRRSGLDLIGSGIDAETGHWIGTW
TGIGAGIDSFFEYAYKSYVLLSRDAHPDYVTPMEAEDPRVLFEALPLEEDTSQAFLEAWN
AAQAAIRRHLYRGPNYQHPHYVQADLITGAARGFWIDALSAFYPGLLTMAGHVEEAVETH
LLQTALWDRFSALPERWSLVTGGIEGGLGWWVGRPEFIESTYYLYRATEDPWYFHVGEMV
LRDIKRRCWTKCGWASIQNVLTGEQTDRMESFFLGETAKYLFLLFDPSHPLNHLDEPFVF
TTEGHPLLIPRSVDNGHHQGKLWNPVPQEEATCPVSPPPLPFSISNIAARGDVYHAANLA
RLHLMPTRDNVESVLGEYAADHPSITLSDISSPSNYTYYPWTLPTDLVPFNATSSLIPTK
PTLDISFPAITNLGQPTPPLQRVKEGILINYIGGLRLGMVRDVPILLGTGIVEAFRIQTI
NNLPLGKDEKVFLARDTGKESLSNTDPNFTRIRDAVMLDIVIELSGPIEPEDMQVNTTDE
TYFLSLRDLERQSAESDSAMRAAWNAIVSQISNLLKDHQPQPSWPFTTPLSIRSTSTSQQ
QAASSSSENTPRYHLAAVTPTGPGAAPLPDWPEVMSMTAAGSQSPPLSWTTVYATDDLCN
HKLPAHVVKTHQVLVVKRGGCNFSAKLANIPTFTPSAHSLQLVIVVSYGSDRVSEDEDPV
GGGGGGGGFDDEEHQLVRPHLDQPQRTPAGLPRHNPIPMVMVGGGKNVYDALATKTVGVG
VKRRYHVETQGVRITNLIIV

Enzyme Prediction     

No EC number prediction in KIW18320.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	65	607	4e-138	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	2.99e-132	64	609	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	6.56e-56	43	610	58	519	glycoside hydrolase family 47 protein; Provisional
224250	YyaL	0.006	235	335	485	567	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUW31064.1|GH47	0.0	58	1084	33	1037
BCR91747.1|GH47	0.0	52	1100	37	1111
QMW34129.1|GH47	0.0	53	1100	39	1090
QMW46185.1|GH47	0.0	53	1100	39	1090
QRD94118.1|GH47	0.0	53	1100	39	1090

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1FMI_A	1.34e-33	48	609	1	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	4.54e-33	49	609	2	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	7.27e-33	50	609	81	534	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
4AYO_A	1.21e-32	50	593	6	421	Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 [Caulobacter sp. K31],4AYP_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with thiomannobioside [Caulobacter sp. K31],4AYQ_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with mannoimidazole [Caulobacter sp. K31],4AYR_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with noeuromycin [Caulobacter sp. K31],5MEH_A Crystal structure of alpha-1,2-mannosidase from Caulobacter K31 strain in complex with 1-deoxymannojirimycin [Caulobacter sp. K31],5NE5_A Crystal structure of family 47 alpha-1,2-mannosidase from Caulobacter K31 strain in complex with kifunensine [Caulobacter sp. K31]
5KIJ_A	2.38e-32	58	609	6	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92611|EDEM1_HUMAN	5.15e-116	51	605	123	582	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|O94726|MNL1_SCHPO	1.15e-115	46	605	24	473	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q925U4|EDEM1_MOUSE	1.69e-115	51	609	118	581	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|P38888|MNL1_YEAST	2.69e-102	50	624	28	517	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL1 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	5.62e-90	55	609	35	478	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.026988	0.973020	CS pos: 48-49. Pr: 0.8941

TMHMM  Annotations     

There is no transmembrane helices in KIW18320.1.