CAZyme Information: KIW17559.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW17559.1
• CAZy Family: GH76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	KN847494|CGC10	43894.59	7.3445

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847494:2800652-2801901(+)

Full Sequence      

MEAGAAPRNINPLHQYSRSRKPLRWAICIVLGTLAILALTGQSYGPDPIRRTSSGAKAKY
LTPAKLMERPISKDLQTVPKLFHQSWSSNELPAKFQRWSTSCRQQHPDWEYILWTDEDNE
KLVATHFPWLLSTYQALPGVIYKADLARNLYMYMFGGVYADLDVECLRPSDELFKRYNVS
TVSHAKPRPMSTYNLQKNGRKAFFGRMGVDTEEANSIPNAWMASTPGHPFFLIVLEHVMR
TMHEGTSDEGPEDTTGPALLFNKINEYLAEDGKFRGENMDKWVSKNPTAKQFTPRRGLGH
SVEVLPFQYIFPYSWQRDGEAVRDVCWATRRSFSAERCKLLLATDHWPSYAITYWSHTWA
GEGHDEGNVDHLNFDEEKEQQH

Enzyme Prediction     

No EC number prediction in KIW17559.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	95	175	4.7e-21	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.55e-26	76	236	80	212	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.52e-18	101	179	10	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO66576.1|GT32	6.97e-105	56	370	76	408
QLI72987.1|GT32	2.10e-88	27	372	16	358
ANH56535.1|GT32	9.81e-80	33	372	63	376
UKZ71055.1|GT32	1.83e-78	58	375	77	373
BCS29894.1|GT32	1.24e-67	42	359	55	380

PDB Hits     

KIW17559.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	3.44e-25	72	240	51	190	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	4.34e-23	74	268	60	230	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	1.32e-20	78	240	82	215	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P38287|CSH1_YEAST	5.47e-19	76	236	60	191	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.81e-16	76	236	53	184	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000014	0.000016

TMHMM  Annotations     

Start	End
23	45