CAZyme Information: KIW17429.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW17429.1
• CAZy Family: GH64
• CAZyme Description: Cellulase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0D2C166]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471	KN847494|CGC6	54627.87	5.6929

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847494:2434343-2435813(+)

Full Sequence      

MSSGILKVKETQVVDGNGTPVILRGAAIGGWLNMENFITGYPGHESSIRAAMLKVMGQEN
YEYFFDRWLYYFFTEADAKFFKSLGLNCIRIPFNYRHFEDDMNPRVLKESGFKHLDRVID
LCAKEGIYTILDMHTVPGGQSPGWHADNTTAYAAFWDYKDHQDRTVWLWEQLARRYKDNP
WIAGYNPINEPCDPQHVRLPAFYARLEKAIRAIDPDHILWLDGNTFAAEWKGFDAVLPNS
VYALHDYSMMGFPTGRPYKGTAEQKERLEAQFLRKSEFQRARKTAIWNGEFGPVYANPKW
DENAEAINQDRYELLGEQLRIYDRFQIPWSIWLFKDVGLQGMVYTSPDSAWNRLIEPILE
KKKRLQLDAWGKYPSKEVEDVMNPLIQWIDEVSPTAKNVYPSTWNTARHVERAVLQTFLA
ETFCEEFAELFRGKGEAELEELAKSFSFENCVQRQGLNKIMSDYASIASKS

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.37:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	49	337	3.1e-124	0.9965034965034965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	2.43e-19	71	306	23	251	Cellulase (glycosyl hydrolase family 5).
225344	BglC	8.23e-17	71	335	72	363	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP80303.1|GH5_22	7.60e-273	1	465	1	465
QMW26442.1|GH5_22	5.29e-271	1	465	1	465
QMW38521.1|GH5_22	5.29e-271	1	465	1	465
UCK59003.1|GH5_22	7.96e-271	1	465	12	476
APA13270.1|GH5_22	6.17e-250	1	465	1	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	1.62e-19	72	363	28	342	Chain A, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	3.99e-19	72	363	28	342	Chain A, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
3AMC_A	4.48e-14	82	359	43	311	Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AZR_A	2.63e-13	82	359	43	311	Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZR_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZS_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZS_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZT_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_C Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_D Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8]
3AMG_A	2.63e-13	82	359	43	311	Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	2.38e-188	6	470	4	474	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|P23340|GUNC_CLOSF	3.37e-19	72	363	28	342	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
sp|A3DJ77|GUNC_ACET2	3.37e-19	72	363	28	342	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
sp|P0C2S3|GUNC_ACETH	8.33e-19	72	363	28	342	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
sp|B0XN12|EXGA_ASPFC	1.06e-15	8	246	30	275	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000077	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KIW17429.1.