CAZyme Information: KIW17129.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW17129.1
• CAZy Family: GH55
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314		35877.84	9.6040

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847494:1605381-1606463(+)

Full Sequence      

MPLTFNHDTTIRISPARDDFDITFEEYTSSAAPSSHARAPGGNDTYPVPAIIHNVFLGSS
DLLRSSWALAAHACRVVHPDYNFEFWDNARAERFVRREYPELWPTWKNYRYDSQRADSLR
YMVLHHYGGIFLDLDLLCLRPLTPLRAFDFVAPAAYPSGISNGFLLSRPKGPFLAEVISN
LPRYDVSWFGLPHATISFSTGCHFLSTMHLFTKTDRSILRILWGPRRLHHLSGNATTPLF
HHFGSSSRHSYNADFFEALKPPPQSLFRIGATRSERDWAAIILFTAIAISTFVATVLFVV
YRLKTRSNRQRLVQ

Enzyme Prediction     

No EC number prediction in KIW17129.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	70	146	2.8e-18	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.61e-26	47	209	81	240	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.07e-11	67	149	4	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ97012.1|GT32	2.54e-71	7	259	56	299
AEO68738.1|GT32	5.50e-71	1	259	45	299
UKZ64181.1|GT32	6.96e-71	7	259	55	298
QRD88351.1|GT32	2.86e-70	13	260	48	290
VBB86275.1|GT32	7.15e-70	13	253	83	325

PDB Hits     

KIW17129.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	2.34e-33	48	208	55	212	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	2.95e-31	18	208	25	219	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	5.58e-30	34	256	52	269	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	4.04e-29	43	206	52	212	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.07e-23	48	218	82	247	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999768	0.000259

TMHMM  Annotations     

Start	End
278	300