CAZyme Information: KIW16955.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW16955.1
• CAZy Family: GH5
• CAZyme Description: Glyco_hydro_32N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0D2BED9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
507		57109.87	5.9903

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

Full Sequence      

MTVDVKRNEDQRPVLHFTPQKGFMNDPNGLVYSNGIWHLYYQLDDRSLVAGHPEWGHATS
NDLLSWRWHKKAIMAPSDHEAIWSGCCVVDRNNTSGQFDESASPDDRIVAIFTIHTQGHQ
TQNVALSSDGGYTFTQYKHNPVLDIGWAHFRDPKVLWHEPSNQWVMVVAKCHQFKVGFYG
SPDLIHWHHLSDFEGSGVRGYQYEMPNLVQVPWDNDSDRKRWVLFLSIGPGAPLGGSFTQ
YFLGDFDGTTFTSSDNYLRTADLGKDWYAAQTWFDSPDGAVYGIGWASNWQYCNRVPAER
YRSAMSLPRKFTVREVSLNVATKSLSLISRPIDLDNARLHTDETAMVYTNGSAKDYPSIQ
VIYERRLQSGSGAFEFKLKIRSGTPAARVSVDIANRSGHSIGLNFLVEVEGMFVSLDRGG
TRTGSSWDHPLFDDKVCMWVPNTQSVYDVHVILDAFVCELFAIDGAYAFTNTFFLQGGVV
STFTVSQDAPITEVFDVYELCSLAPAK

Enzyme Prediction     

EC	3.2.1.26:14	3.2.1.7:6	3.2.1.153:2	3.2.1.80:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	16	316	2.9e-89	0.9692832764505119

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
350134	GH32_Inu-like	4.44e-143	21	312	1	288	glycoside hydrolase family 32 protein such as Aspergillus ficuum endo-inulinase (Inu2). This subfamily of glycosyl hydrolase family GH32 includes endo-inulinase (inu2, EC 3.2.1.7), exo-inulinase (Inu1, EC 3.2.1.80), invertase (EC 3.2.1.26), and levan fructotransferase (LftA, EC 4.2.2.16), among others. These enzymes cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
224536	SacC	9.06e-110	8	474	25	458	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
214757	Glyco_32	3.66e-101	16	465	1	437	Glycosyl hydrolases family 32.
395193	Glyco_hydro_32N	5.74e-91	16	315	1	299	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
350110	GH32_FFase	1.83e-65	22	313	1	281	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCE82332.1|GH32	CCE82332.1|GH32	2.54e-125	6	478	4	482
SGZ56329.1|GH32	SGZ56329.1|GH32	5.41e-125	12	478	17	486
ABW70125.2|GH32|3.2.1.153	ABW70125.2|GH32|3.2.1.153	5.58e-125	9	477	17	482
ABW75766.2|GH32	ABW75766.2|GH32	2.23e-124	9	477	17	482
CCF77887.1|GH32|3.2.1.153	CCF77887.1|GH32|3.2.1.153	1.03e-121	11	477	16	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3KF3_A	3KF3_A	1.06e-121	3	478	1	480	Chain A, Invertase [Schwanniomyces occidentalis],3KF3_B Chain B, Invertase [Schwanniomyces occidentalis]
3KF5_A	3KF5_A	1.16e-121	3	478	4	483	Chain A, Invertase [Schwanniomyces occidentalis],3KF5_B Chain B, Invertase [Schwanniomyces occidentalis]
3U75_A	3U75_A	1.86e-120	3	478	27	506	Chain A, Fructofuranosidase [Schwanniomyces occidentalis],3U75_B Chain B, Fructofuranosidase [Schwanniomyces occidentalis],3U75_C Chain C, Fructofuranosidase [Schwanniomyces occidentalis],3U75_D Chain D, Fructofuranosidase [Schwanniomyces occidentalis]
3U14_A	3U14_A	3.71e-120	3	478	27	506	Chain A, Fructofuranosidase [Schwanniomyces occidentalis],3U14_B Chain B, Fructofuranosidase [Schwanniomyces occidentalis],6S1T_A Chain A, Fructofuranosidase [Schwanniomyces occidentalis],6S1T_B Chain B, Fructofuranosidase [Schwanniomyces occidentalis],6S2B_A Chain A, Fructofuranosidase [Schwanniomyces occidentalis],6S2B_B Chain B, Fructofuranosidase [Schwanniomyces occidentalis]
6J0T_A	6J0T_A	1.91e-113	12	476	39	526	The crystal structure of exoinulinase INU1 [Kluyveromyces marxianus DMKU3-1042],6J0T_B The crystal structure of exoinulinase INU1 [Kluyveromyces marxianus DMKU3-1042]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5DHM6|INUE_PICGU	sp|A5DHM6|INUE_PICGU	9.91e-126	9	477	17	482	Extracellular exo-inulinase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) OX=294746 GN=PGUG_02777 PE=1 SV=2
sp|A8W7I5|INUE_PICGM	sp|A8W7I5|INUE_PICGM	7.90e-125	9	477	17	482	Extracellular exo-inulinase inuE OS=Meyerozyma guilliermondii OX=4929 PE=1 SV=3
sp|P40912|INV1_WICAO	sp|P40912|INV1_WICAO	9.48e-121	12	482	28	524	Invertase OS=Wickerhamomyces anomalus OX=4927 GN=INV1 PE=3 SV=1
sp|Q6BJW6|INV_DEBHA	sp|Q6BJW6|INV_DEBHA	4.61e-114	12	476	35	504	Invertase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=INV PE=3 SV=2
sp|P28999|INU1_KLUMA	sp|P28999|INU1_KLUMA	2.68e-112	12	476	39	525	Inulinase OS=Kluyveromyces marxianus OX=4911 GN=INU1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KIW16955.1.