CAZyme Information: KIW16938.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW16938.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		42774.62	6.9829

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847494:1049157-1050352(+)

Full Sequence      

MRKPSKAALGSRLNMTFSTNTRRIAAVAVALVILFLLLRPTSSSSFDSDLIHSTAQSADR
PSRSYPPPKPGQKSTSEESAPRALVSKPLRERLRYHFPYDIESKFPAYVWQTWKEGPGSG
KFEARLRPFEATWTTLHPWFVHEVVTDDAAVHLINYLYASIPDVVEAYEAMPLPVLKADF
FRYLILLARGGIYSDIDTSALKSATEWLPESLDKSQIGLVVGIEADPDRPDWNEWYARRI
QFCQWTIQSKPGHPVLRDIVATVTEDTLAMKKAGRLQVGKTPDKSIMEFTGPGVWTDALF
SYFNNRDFFDFSSRTSNITYSDFFAITEHKKIGDVIVLPITSFSPGVGQMGAEGPDHPMA
FVKHEFDGSWKPADERMNSV

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	131	210	3.8e-19	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.80e-42	87	371	64	345	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.48e-18	132	211	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM11372.1|GT32	6.70e-150	84	371	63	353
QKX63547.1|GT32	2.81e-149	84	376	72	362
QHY93508.1|GT32	1.21e-148	84	376	96	386
APA11100.1|GT32	3.87e-148	45	376	27	356
ABA38731.1|GT32	7.22e-148	84	368	34	321

PDB Hits     

KIW16938.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	1.28e-95	89	371	83	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	2.09e-82	95	371	132	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	9.91e-76	89	371	80	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	3.17e-75	89	371	114	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.982126	0.017899

TMHMM  Annotations     

Start	End
21	38