CAZyme Information: KIW16885.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW16885.1
• CAZy Family: GH5
• CAZyme Description: Dolichyl-phosphate beta-glucosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A0D2BE62]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436		48610.96	7.3212

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847494:904827-906184(-)

Full Sequence      

MGIMGGHFVGMFGTRDEWFNLRMLPFILIWAIFAIVFLIWLFITLFVPNPRPPFPQEKQF
TTVDKTGDVTDPEPLPCWYEDMIRRYGQARREDPEREIEVERDIGIEPAEVFMTLVVPAF
NEEDRLSGMLEEAVNFLETEYGTSKSDENTGLDTLAETATATTTTDTSQTPRKRKTKSAK
ANGTPTPAAPLRGWEIILVDDGSTDHTLLTAQTFSRKHILPAQPRRDSGPWTHRSPKGVS
IPPGSIRMVSLLSNRGKGGAVVHGMRHARGQYVLFADADGASKFSDLSKLVSSLRSIEDE
SGRGVAVGSRAHLVGSDAVVKRSKLRNFLMHSFHLLLKFMTPPATARIADTQCGFKLFSR
ASLPHIVPHMHMEGWIFDVEMLMLAEFSGIPVVEVPIGWREVMGSKLNVVRDSIGMAWGL
ALLRLCWGTGIYRKGE

Enzyme Prediction     

No EC number prediction in KIW16885.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	115	353	5.7e-19	0.9235294117647059

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
240336	PTZ00260	1.98e-88	26	433	11	322	dolichyl-phosphate beta-glucosyltransferase; Provisional
133031	DPG_synthase	1.29e-85	115	406	1	211	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
133022	DPM_DPG-synthase_like	2.12e-40	115	385	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
395426	Glycos_transf_2	4.14e-17	194	363	28	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
133062	DPM1_like	2.90e-15	194	408	28	210	DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP98894.1|GT2	1.62e-154	48	434	48	413
QQK43234.1|GT2	3.49e-154	41	434	41	415
QVM11118.1|GT2	4.78e-154	31	434	32	413
AAF01464.1|GT2	7.58e-151	48	434	38	405
QSS59528.1|GT2	8.07e-151	48	434	50	417

PDB Hits     

KIW16885.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O60061|ALG5_SCHPO	6.54e-70	113	434	64	315	Dolichyl-phosphate beta-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg5 PE=3 SV=1
sp|P40350|ALG5_YEAST	2.87e-68	34	436	21	332	Dolichyl-phosphate beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG5 PE=1 SV=1
sp|Q54J42|ALG5_DICDI	8.59e-52	111	433	74	324	Dolichyl-phosphate beta-glucosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg5 PE=2 SV=1
sp|Q9VLQ1|ALG5_DROME	2.87e-47	113	433	68	317	Dolichyl-phosphate beta-glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=wol PE=1 SV=1
sp|Q9Y673|ALG5_HUMAN	8.16e-45	113	433	67	316	Dolichyl-phosphate beta-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000004

TMHMM  Annotations     

Start	End
21	43