CAZyme Information: KIW16575.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW16575.1
• CAZy Family: GH47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	KN847494|CGC11	44331.48	5.4088

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847494:108531-109718(+)

Full Sequence      

MQSATTPVLGGCLPKQIRRALPVCLVLVLLALVLMTAGSLGEFSAEVSYHASMASGRFPR
KIWQTWKVDPLDFEERDLTTARTWIMKNPDHRYEVLTDQNDLYYVETYFGPAGFNRPDIV
HTYKSLTARIVKADLLRYLVMYAEGGVYTDIDVEALKPIERFIPSRYNEKDVDMVIGIEI
DQPEFHNHSILGGKCESFCQWTFMSKPRLPVMMRLINNILKWLNEVSRKQGVPISDIQLD
FDEVISGTGPSAFTRAIMEEMAVRTGEAVHWDCFHNLGESKLVGGILVLTVEAFAAGQGH
SDSGNHNAKTALVKHHYHASGWPTTHPRYTHPVYGEVERCNWDADCVREWDENKAAFDAL
SPEEQANQIAMKEAADAALLSAETGFPAEGQLTIP

Enzyme Prediction     

No EC number prediction in KIW16575.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	79	164	4.3e-19	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.86e-23	58	223	82	247	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.05e-15	75	164	2	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX62098.1|GT32	5.24e-196	8	378	4	375
QMW40889.1|GT32	4.17e-189	10	377	3	370
BAE58544.1|GT32	4.17e-189	10	377	3	370
UDD56882.1|GT32	4.17e-189	10	377	3	370
BCS17076.1|GT32	4.85e-189	10	378	27	393

PDB Hits     

KIW16575.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	2.61e-36	43	322	132	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.74e-29	58	320	99	374	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	4.22e-26	57	294	129	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	2.96e-24	59	320	97	468	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.34e-06	52	153	51	143	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999686	0.000323

TMHMM  Annotations     

Start	End
21	43